KEGG   Poecilia reticulata (guppy): 103471253
Entry
103471253         CDS       T05149                                 

Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X2
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04012  ErbB signaling pathway
pret04068  FoxO signaling pathway
pret04137  Mitophagy - animal
pret04140  Autophagy - animal
pret04141  Protein processing in endoplasmic reticulum
pret04210  Apoptosis
pret04217  Necroptosis
pret04310  Wnt signaling pathway
pret04510  Focal adhesion
pret04530  Tight junction
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04625  C-type lectin receptor signaling pathway
pret04910  Insulin signaling pathway
pret04912  GnRH signaling pathway
pret04914  Progesterone-mediated oocyte maturation
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103471253
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103471253
   04012 ErbB signaling pathway
    103471253
   04310 Wnt signaling pathway
    103471253
   04068 FoxO signaling pathway
    103471253
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103471253
   04137 Mitophagy - animal
    103471253
  09143 Cell growth and death
   04210 Apoptosis
    103471253
   04217 Necroptosis
    103471253
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103471253
   04530 Tight junction
    103471253
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103471253
   04621 NOD-like receptor signaling pathway
    103471253
   04622 RIG-I-like receptor signaling pathway
    103471253
   04625 C-type lectin receptor signaling pathway
    103471253
  09152 Endocrine system
   04910 Insulin signaling pathway
    103471253
   04920 Adipocytokine signaling pathway
    103471253
   04912 GnRH signaling pathway
    103471253
   04914 Progesterone-mediated oocyte maturation
    103471253
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103471253
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103471253
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103471253
Protein kinases [BR:pret01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103471253
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 103471253
NCBI-ProteinID: XP_008418354
LinkDB
Position
LG10
AA seq 420 aa
MSEAEGQFYSVQVGDSTFTVLKRYQQLRAIGSGAQGIVCSALDTVLGIPVAVKKLCRPFQ
NQTHAKRAYRELVLLKCVNHKNIIRLINVFTPQKSLEEFQDLYLVMELMDASLCQVIHMD
LDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEILG
TPSVEFMNRLMETVRNYVMNKPQYPGVSFTELFPDWAFPSESEQDKVKTVQARDLLSKML
VIDPECRISVEEALHHPYIHVWYDPAEADAPPPQISDKQLEEREHSIEQWKELIYEEVMD
WEERNKNGLMKEDCSDVASSSASQSSSANDISSMSTEHTLASDTDSSSIDTLTGPLDESQ
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgagtgaggcggagggccagttctacagtgtccaggtgggcgactccaccttcactgtg
ctcaagcgctaccagcagcttcgtgccattggctcaggggcccaaggcattgtctgctct
gctctggatacagtcctcggtataccagtggctgtgaagaagctctgtcggccttttcag
aaccagacccatgcaaagcgggcctacagggaactggtgctgctgaaatgtgtcaaccac
aaaaatatcatccgtctgatcaatgttttcacgcctcagaagtctctggaggagttccag
gatctttacctggtgatggagctgatggatgccagcttatgtcaggtgattcacatggac
ctggaccacgagaggatgtcctacctgctctatcagatcctttgtggcatcaggcacctg
cactcagctgggatcatccacagagatctgaagcccagcaacattgttgtgaagtctgat
tgcactctgaaaatccttgactttggtctcgcacggacggcttgcacaaacttcatgatg
accccctacgtagtaacccgatactaccgcgccccggaggtcatcctgggcatgaagtat
aaggagaacgtggacatctggtcagtggggtgcatcatgggagagatggtaaaaggcagc
gtcatcttccagggcaccgatcacatcgaccagtggaataaagtgattgagattctgggt
acgcccagcgtcgagtttatgaaccgactgatggagaccgtaaggaactatgtgatgaac
aagccgcagtatccaggcgtcagcttcacagagctgttcccggattgggcttttccttct
gaatctgaacaagacaaagtgaaaactgttcaagctcgggatctgctctccaaaatgctg
gtcattgatccggaatgccgcatctcggtggaggaagcccttcatcacccctacatccac
gtgtggtacgaccccgcagaggcggacgcgcctcctcctcagatttcagataagcagctg
gaagagagagagcacagcatcgagcagtggaaagaacttatttatgaagaagtgatggac
tgggaggagaggaacaagaacggtctaatgaaagaagactgctcagatgtggcgtccagt
tccgcttcccagtcgtcctcggccaacgacatttcgtccatgtccacagagcacacgctg
gcgtcggacacagacagcagcagcatcgacacgctgacggggccgctcgacgagagtcag
tga

KEGG   Poecilia reticulata (guppy): 103473893
Entry
103473893         CDS       T05149                                 

Gene name
mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04012  ErbB signaling pathway
pret04068  FoxO signaling pathway
pret04137  Mitophagy - animal
pret04140  Autophagy - animal
pret04141  Protein processing in endoplasmic reticulum
pret04210  Apoptosis
pret04217  Necroptosis
pret04310  Wnt signaling pathway
pret04510  Focal adhesion
pret04530  Tight junction
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04625  C-type lectin receptor signaling pathway
pret04910  Insulin signaling pathway
pret04912  GnRH signaling pathway
pret04914  Progesterone-mediated oocyte maturation
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103473893 (mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103473893 (mapk10)
   04012 ErbB signaling pathway
    103473893 (mapk10)
   04310 Wnt signaling pathway
    103473893 (mapk10)
   04068 FoxO signaling pathway
    103473893 (mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103473893 (mapk10)
   04137 Mitophagy - animal
    103473893 (mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    103473893 (mapk10)
   04217 Necroptosis
    103473893 (mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103473893 (mapk10)
   04530 Tight junction
    103473893 (mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103473893 (mapk10)
   04621 NOD-like receptor signaling pathway
    103473893 (mapk10)
   04622 RIG-I-like receptor signaling pathway
    103473893 (mapk10)
   04625 C-type lectin receptor signaling pathway
    103473893 (mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103473893 (mapk10)
   04920 Adipocytokine signaling pathway
    103473893 (mapk10)
   04912 GnRH signaling pathway
    103473893 (mapk10)
   04914 Progesterone-mediated oocyte maturation
    103473893 (mapk10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103473893 (mapk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103473893 (mapk10)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103473893 (mapk10)
Protein kinases [BR:pret01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103473893 (mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 103473893
NCBI-ProteinID: XP_008422756
LinkDB
Position
LG12
AA seq 467 aa
MVFMSRHFLYNCSQPVLDVKIAFCQGFGKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDST
FTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGI
KHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILG
MGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNY
VENRPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRISVDEALQHP
YINVWYDPAEVEAPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNGVVKGQPSPS
GAAVNSSESLPPSSSINDISSMSTDQTLASDTDSSLETSAGPLGCCR
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggtatttatgagcagacatttcttatataactgcagccaaccagtcctggatgtaaag
atagccttttgtcagggttttggcaaacaagtggatgtgtcatatattgccaaacattac
aacatgagcaaaagcaaagtggacaaccagttctacagtgtggaagtgggagactccacc
ttcacagttctaaagcgttaccagaatttaaagcccattggttctggagctcagggaatt
gtctgtgcgggctatgatgctgtcctggacaggaatgttgccataaagaaactgagcaga
cccttccagaaccagacccacgccaagagggcataccgggagttggtgctcatgaaatgt
gtcaatcacaaaaatataatcagtttattaaatgtcttcacgccacagaaatcattagag
gaattccaagatgtgtacctcgtgatggagctcatggatgccaacttgtgccaggtgatt
cagatggagcttgaccacgagagaatgtcctatctgctctaccagatgctatgcggaatc
aaacatctgcactcagccggcattattcacagggatctcaaaccaagcaatatagtggtg
aagtctgattgcaccctgaagatcctggacttcggtctggctagaaccgcgggcactagt
ttcatgatgaccccatatgtggtgacgcgatactacagagccccagaggtcatcctggga
atgggatacaaagaaaatgtggacatttggtcggtggggtgcatcatgggagaaatggtg
cgtcacaaaatccttttccctggccgggactacattgaccagtggaacaaggtgatagag
cagctgggcacgccctctccagagttcatgaagaagctgcagcccacggtcaggaactac
gtggagaaccggccaaagtacgcgggcctcaccttccccaagctcttccccgactgcctt
ttccctgctgactctgagcacaacaaactcaaagcaagccaggccagggacctgctgtct
aagatgctgatcatcgaccctgctaagcggatatcggtggacgaggccttacagcacccc
tacatcaacgtgtggtacgatccagctgaggtggaggcgcctccacctcagatttatgac
aagcagctggatgaacgagaacactcgatagatgagtggaaagaactaatctacaaagag
gtgatgaactttgaggaaagaacgaagaatggcgttgtgaagggacagccttcaccttca
ggtgcagccgtgaacagcagcgagagcctccctccctcctcctctatcaacgacatctcc
tccatgtccaccgaccagaccctggcttcagacactgacagcagcctggagacctccgcg
ggacccctggggtgctgcaggtga

KEGG   Poecilia reticulata (guppy): 103476945
Entry
103476945         CDS       T05149                                 

Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04012  ErbB signaling pathway
pret04068  FoxO signaling pathway
pret04137  Mitophagy - animal
pret04140  Autophagy - animal
pret04141  Protein processing in endoplasmic reticulum
pret04210  Apoptosis
pret04217  Necroptosis
pret04310  Wnt signaling pathway
pret04510  Focal adhesion
pret04530  Tight junction
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04625  C-type lectin receptor signaling pathway
pret04910  Insulin signaling pathway
pret04912  GnRH signaling pathway
pret04914  Progesterone-mediated oocyte maturation
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103476945
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103476945
   04012 ErbB signaling pathway
    103476945
   04310 Wnt signaling pathway
    103476945
   04068 FoxO signaling pathway
    103476945
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103476945
   04137 Mitophagy - animal
    103476945
  09143 Cell growth and death
   04210 Apoptosis
    103476945
   04217 Necroptosis
    103476945
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103476945
   04530 Tight junction
    103476945
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103476945
   04621 NOD-like receptor signaling pathway
    103476945
   04622 RIG-I-like receptor signaling pathway
    103476945
   04625 C-type lectin receptor signaling pathway
    103476945
  09152 Endocrine system
   04910 Insulin signaling pathway
    103476945
   04920 Adipocytokine signaling pathway
    103476945
   04912 GnRH signaling pathway
    103476945
   04914 Progesterone-mediated oocyte maturation
    103476945
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103476945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103476945
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103476945
Protein kinases [BR:pret01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103476945
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like
Other DBs
NCBI-GeneID: 103476945
NCBI-ProteinID: XP_008427928
LinkDB
Position
LG15
AA seq 507 aa
MDSASAVWMTEEGGGTVYAELEKMKDLFELHVIKQSTVSTGTNLRFVFKRTFLDAQKAVI
EDFAMNKNKRDREFYSVDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDQILERNVAIKK
LSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEDFQDVYLVMELMDANLC
QVIQMELDHERLSYLLYQMLCGIKHLHGAGIIHRDLKPSNIVVKSDCTLKILDFGLARTA
ATGLLMTPYVVTRYYRAPEVILGMGYQANVDIWSVGCILAEMVRHKILFPGRDYIDQWNK
VIEQLGTPSQDFLMKLNHSVRTYVENRPRYAGYTFEKLFPDVLFPADSDHNKLKASQARD
LLSKMLVIDASKRISVDEALHHPYINVWYDPAEVEAPPPKIPDRTLDEREHTVEEWKELI
YKEVIEWEERTKNGVIRGQPTALGAAVIDSPPQPTSSSSSSSSSSSANDVSSMSTEPTDP
GSDPALGSETDSSLDSHTSLSALACCR
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggactcggcgtcggctgtgtggatgaccgaggagggtggtggcactgtttatgcagag
ctggagaaaatgaaagatctgtttgagcttcatgtaatcaaacagtcgacagtctccact
ggcacaaaccttcgttttgtgtttaagaggacatttttggatgcacagaaagcagtaata
gaagactttgccatgaacaaaaacaagagagacagggagttctacagtgtagacgtcggg
gattcaacgtttacagtactgaagcgataccagaatctaagacccatcggctcaggagca
cagggaatcgtctgctctgcttatgaccaaatccttgaacgaaatgttgccatcaagaag
ctgagtcgaccctttcaaaatcaaacccatgctaagagggcgtacagagagctagtccta
atgaaatgtgtcaatcacaaaaatatcattggcctgttaaatgtattcacgccacaaaaa
tcgctagaagatttccaagatgtatacttggtaatggagctgatggatgccaacctgtgt
caagtgattcaaatggagctggaccatgagaggctgtcatacctgctctatcagatgttg
tgtggcatcaaacacctccacggtgccgggatcatacacagggatctgaagcccagcaat
atagttgtcaagtctgattgcacgctgaagattttggactttggcttggctcggacggca
gccacaggcctcctgatgacgccatatgtggttacacgctactacagagcaccagaagtt
atcctgggcatgggctaccaggccaatgtggacatatggtctgtgggctgcattctggca
gaaatggttcgccataaaatccttttccctggaagggactatatcgaccagtggaacaag
gtgattgagcagctaggcactccatctcaggattttctaatgaaactgaatcactcagtg
agaacgtatgtagaaaacagaccgcggtatgccggatacacttttgagaagctcttccca
gatgtgctcttccctgctgactctgatcacaacaaactgaaagcaagccaagccagagac
ctgttatccaagatgctggtgattgatgcgtcaaagcgcatctctgtggatgaagccctg
caccacccatatattaatgtttggtacgatcctgctgaagtggaagcgccgcctccaaag
atcccagacaggacactggatgaaagagagcacactgtggaggagtggaaagagctaatt
tataaggaagtgatcgaatgggaggaacgaacaaaaaatggagtgatcagaggtcaaccc
actgctttaggtgcagcagtgatcgacagtcctcctcagcccacatcttcctcctcttct
tcttcctcctcctcctcagccaacgacgtctcctccatgtccacagagccgaccgatccc
ggcagtgatcccgctttgggctccgagacagacagcagcttggacagccacacctccctc
agtgcgctggcctgctgcagataa

KEGG   Poecilia reticulata (guppy): 103482024
Entry
103482024         CDS       T05149                                 

Gene name
mapk8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X2
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04012  ErbB signaling pathway
pret04068  FoxO signaling pathway
pret04137  Mitophagy - animal
pret04140  Autophagy - animal
pret04141  Protein processing in endoplasmic reticulum
pret04210  Apoptosis
pret04217  Necroptosis
pret04310  Wnt signaling pathway
pret04510  Focal adhesion
pret04530  Tight junction
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04625  C-type lectin receptor signaling pathway
pret04910  Insulin signaling pathway
pret04912  GnRH signaling pathway
pret04914  Progesterone-mediated oocyte maturation
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103482024 (mapk8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103482024 (mapk8)
   04012 ErbB signaling pathway
    103482024 (mapk8)
   04310 Wnt signaling pathway
    103482024 (mapk8)
   04068 FoxO signaling pathway
    103482024 (mapk8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103482024 (mapk8)
   04137 Mitophagy - animal
    103482024 (mapk8)
  09143 Cell growth and death
   04210 Apoptosis
    103482024 (mapk8)
   04217 Necroptosis
    103482024 (mapk8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103482024 (mapk8)
   04530 Tight junction
    103482024 (mapk8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103482024 (mapk8)
   04621 NOD-like receptor signaling pathway
    103482024 (mapk8)
   04622 RIG-I-like receptor signaling pathway
    103482024 (mapk8)
   04625 C-type lectin receptor signaling pathway
    103482024 (mapk8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103482024 (mapk8)
   04920 Adipocytokine signaling pathway
    103482024 (mapk8)
   04912 GnRH signaling pathway
    103482024 (mapk8)
   04914 Progesterone-mediated oocyte maturation
    103482024 (mapk8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103482024 (mapk8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103482024 (mapk8)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103482024 (mapk8)
Protein kinases [BR:pret01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103482024 (mapk8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 103482024
NCBI-ProteinID: XP_008436153
LinkDB
Position
LG19
AA seq 429 aa
MNRNKREKEYYSIDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGTDHIDQWNKVIEQ
LGTPSQEFLMKLNQSVRTYVENRPRYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPTEVEAPPPAITDKQLDEREHTVEEWKELIYKEV
LDWEERTKNGVIRGQPASIGAAVSSSPQQQHQHHPSTSLSSDPTLTDTDSSLETAPGPAG
HPGPVGCCR
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgaaccggaacaagcgtgaaaaggagtattacagcatagatgtgggcgattcaactttt
acggtcctgaagcgctaccagaacctcagacctattggatccggagcacagggaatcgtc
tgttctgcatatgaccacaacctggagaggaacgttgccatcaagaagctgagccggccc
ttccagaaccaaacccacgccaagcgggcctacagggagctggtgctcatgaaatgtgtc
aatcacaagaacatcatcggcctgttaaacgtattcacgcctcagaagacactggaggag
ttccaagatgtgtatctggtgatggagctgatggacgccaacctgtgtcaagtgattcag
atggagctggaccacgagaggctgtcctacctgctctaccagatgctgtgtgggattaaa
cacctccatgctgcaggcatcatacacagggacctgaagcccagcaacattgtagtaaag
tctgactgcacactgaagatcctggactttggccttgccaggaccgctgccaccggcctc
ctcatgacaccctacgtagtgacccgctactaccgcgcccccgaggtcatcctgggcatg
ggttaccaggccaacgttgatgtctggtctgttggatgcatcatggctgaaatggtccga
ggtagtgtgttgtttccaggcactgatcatattgaccagtggaacaaggtgatcgagcag
ctggggacgccgtctcaggagttcctcatgaagctcaaccagtcggtgaggacctacgtg
gagaaccggccgcgttacgctggctacagctttgagaagctcttccccgatgtcctgttt
cctgctgactctgaacacaacaagctgaaggcgagccaagccagggaccttctatccaaa
atgctggtaatagacgcttccaagcggatctctgtggacgaggctctccagcacccttac
attaacgtgtggtacgatccgactgaagtggaggcaccgccgcccgccatcacagacaag
cagctggacgagcgggagcacacagtggaggagtggaaagagttgatatataaagaagtg
ctggactgggaggaaaggacaaagaatggcgtcatcaggggacagcctgcgtctataggt
gcagcagtgagcagcagccctcagcagcagcaccagcaccatccctccacatccttgtcc
tctgaccccaccctgaccgacacggacagcagcctggagacggcccccggccccgcgggc
cacccaggccccgtgggctgctgcagatga

DBGET integrated database retrieval system