KEGG   Poecilia reticulata (guppy): 103471905
Entry
103471905         CDS       T05149                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: nuclear factor NF-kappa-B p105 subunit-like
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04210  Apoptosis
pret04218  Cellular senescence
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04623  Cytosolic DNA-sensing pathway
pret04625  C-type lectin receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103471905
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103471905
   04218 Cellular senescence
    103471905
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103471905
   04621 NOD-like receptor signaling pathway
    103471905
   04622 RIG-I-like receptor signaling pathway
    103471905
   04623 Cytosolic DNA-sensing pathway
    103471905
   04625 C-type lectin receptor signaling pathway
    103471905
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103471905
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103471905
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103471905
Transcription factors [BR:pret03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    103471905
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank Ank_5 Ank_3 Ank_4 Death
Other DBs
NCBI-GeneID: 103471905
NCBI-ProteinID: XP_017162529
LinkDB
Position
LG10
AA seq 881 aa
MAADENYLHASSQMFDTMMDPSFLEYSHFVPMPQMTAVQSVDGPYLQILEQPKQRGFRFR
YGCEGPSHGGLPGASSEKNRKTYPTVKICNYQGQARVVVQLVTALTQLPQLHAHSLVGKQ
CDKGICIADLQSKDSTISFPNLGILHVTKKNVAKTLEERMVEAFRMGYNCGVAIHPEVDA
LQGEVRVPRELSDQQRSLISSAAAAQAKEMDLSVVRLMFTAFLPDSDGGFSRRLEPSVSE
PIYDSKAPNASNLKIVRMDRTAGCVTGGEEVYLLCDKVQKDDIQVRFYEEDDSGLTWEAL
GDFSPTDVHRQFAIVFKTPKYRDQNLQKPTSVFVQLKRKSDNETSEPKPFTYHPQIIGPK
RGSVEALQSEAADDSGDDSDPDTDPAPGAALRGSAQSGGSAQSGASSVDPDEALMEATRR
QLDALFRYSVTGDSAYLLAPQRPLMAAQDEDGDTGLHLAVLHSQQEALTSLTQVVSALTG
GEVLNMRNHLYQTPLHLAVITQQKQAAEVLLLAGADPTLTDRHGNTVLHLAAQQEGDGMV
ELLLRRREMRGMMQLSNTGGLCAIHLAVLANRLAALRELLVGGADVEAQERSGGRTALHL
ATEADNVSLAGCLLLEGNAKVDSCTFNGSTPLHVAAGRGSVKLTALLMAAGADPHRENFE
PLFIRDEEEEDNEEEEEDEGYISGTTPVNMAASPEVLDLLNGQEYEPRSQRAFIPPQGDL
SVLDVQVKRAVCGALEAEGCWENLAHHLGLGILNTAFRLSPNPARTLLESYEVSGGTVSD
LLAALRSAGGCRALSVLEGALRQNPDMAEEVQNPPVQNLKRTSGTTAASATAGWSSPRRS
ALIGQHPHPPLHQILIYFKELLTQLDRAGSDRTGLLNSDLY
NT seq 2646 nt   +upstreamnt  +downstreamnt
atggctgctgacgagaactacctgcacgcctccagccagatgttcgacaccatgatggac
ccgtccttcctggagtattcccacttcgtcccgatgccgcagatgacggctgtgcagtca
gtggacggaccgtacctgcagatcctggagcagcccaaacagcgcggcttcaggttccgc
tacggctgcgaaggtccgtcgcacggcggcctgccgggagcctctagcgagaagaacagg
aagacgtacccgacggtgaagatatgtaactaccagggtcaggcccgggtcgtggtccag
ctggtgacggcgctgacccagctgccgcagcttcacgcccacagcctggtggggaagcag
tgcgataaaggcatctgcatcgctgacctgcagtccaaagactccaccatcagttttccc
aacctggggatcctccatgtgaccaagaagaacgtggcgaagacgctggaggagcggatg
gtggaggccttcaggatgggctacaactgcggcgtcgccatccacccggaggtcgacgcg
ctgcagggggaggtccgggtcccgcgggagctcagcgaccagcagcgcagcctgatcagc
agcgccgcagccgcccaggccaaagagatggacctgagcgtggtgcgcctcatgttcacc
gccttcctgcccgacagcgacggcggcttctcccgacgcctggagccctcggtgtccgag
cccatctacgacagcaaggctccaaacgcctcaaacctgaagatcgtcaggatggaccgg
accgccggctgcgtgacggggggagaggaggtctacctgctctgtgacaaggtgcagaaa
gatgacattcaggtgcggttctacgaggaggacgactcaggcctgacctgggaggctctg
ggcgatttctcccccacagacgtccacagacagtttgccatcgtcttcaagaccccgaag
tatcgagaccaaaacctgcagaagccaacgtctgtcttcgtccagctaaagaggaaatcc
gacaacgagaccagcgagcccaaacccttcacctaccatccgcagatcataggacccaaa
cgtggttctgttgaagctttgcagagtgaagctgcagacgacagcggcgacgacagcgac
ccggacaccgacccggcgccgggcgctgcgctacgaggctccgcccagtcaggaggttcc
gcccaatcaggtgcctccagtgtggatccagacgaggcgctgatggaggcgacccgccgg
cagctcgacgctctcttccgatactccgtcaccggcgactcggcgtacctgctggctcca
cagcgccctctgatggcggcacaggacgaagacggagacactgggctgcatctggcggtg
ctgcacagccagcaggaggcgctgacgagtctgacacaggtggtgtccgccctgacgggg
ggagaggtgctcaacatgaggaaccacctgtaccagactcctctgcacctggcggtcatc
actcagcagaagcaggcggccgaagttctgctgctggccggcgctgacccgacgctgaca
gatcgccacggcaacacggtccttcacctggcggcgcagcaggaaggagacgggatggtg
gagcttctactgcgacgcagagagatgagaggcatgatgcagctcagcaacacaggaggt
ctgtgtgccatccacctggcggtgttggccaatcggctggcggcgctgagggagctgctg
gtgggcggggccgacgtagaggctcaggagcgcagcggcggccgcaccgcgctgcacctc
gccacggaggccgacaacgtgtcgctggccggctgcctgctgctggagggaaacgccaag
gtggacagctgcaccttcaacggctccacccccctgcatgtggccgcggggcggggctcc
gtcaagctgacggctctgctgatggctgcaggtgccgacccgcacagggagaactttgag
ccgctcttcatcagggacgaggaagaggaggacaatgaggaggaggaggaggatgaaggc
tacatctcaggaaccactccagtcaacatggccgcctcccctgaggttctggatcttcta
aatggtcaggaatacgaacccaggagccagcgagccttcatcccgccgcagggcgacctg
tcggttctggacgtgcaggtgaagcgggccgtgtgcggcgctctggaggctgaaggatgc
tgggagaacctggctcaccatctgggcctcggcatcctgaacacggcgttccggctgagt
ccaaacccggccagaaccctgctggagagctacgaggtttctggtggaaccgtttcggac
ctgctggcggctctccggtcggccggcggctgcagagcgctgagcgtcctggagggggcg
ctgcgccagaacccggacatggcagaggaggtccagaaccctccggtccagaacctgaag
cggacctcgggaacgacagcggcgtctgcgacagcggggtggagctctccacggcgtagc
gctctgattggccagcatcctcatcctcctcttcatcagattctcatctattttaaggaa
ctgctgacacaactggaccgggccgggtcggaccggaccggactgctgaactctgatctc
tactga

KEGG   Poecilia reticulata (guppy): 103480184
Entry
103480184         CDS       T05149                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor p65-like
  KO
K04735  transcription factor p65
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04137  Mitophagy - animal
pret04210  Apoptosis
pret04218  Cellular senescence
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04623  Cytosolic DNA-sensing pathway
pret04625  C-type lectin receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103480184
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103480184
  09143 Cell growth and death
   04210 Apoptosis
    103480184
   04218 Cellular senescence
    103480184
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103480184
   04621 NOD-like receptor signaling pathway
    103480184
   04622 RIG-I-like receptor signaling pathway
    103480184
   04623 Cytosolic DNA-sensing pathway
    103480184
   04625 C-type lectin receptor signaling pathway
    103480184
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103480184
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103480184
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103480184
Transcription factors [BR:pret03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    103480184
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 103480184
NCBI-ProteinID: XP_008433278
LinkDB
Position
LG18
AA seq 662 aa
MDGVYGWGMTSINPVQPASPYIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTYP
AIKVHNYSGPLRVRISLVTKNPPHKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQC
VKKKDVNEAITCRLQTSNNPFSIPEPKVWEEEFDLNSVRLCFQASITLPTGEMFPLPPVV
SQPIFDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTF
SQADVHRQVAIVFRTPPYRDTNLSEPIKVKMQLRRPSDREVSEPMDFQFLPADPDEYRLT
EKRKRTGDMFQSLKLGSMLSTVSVPQDRRHINLARRPVAAKLSSMSTQAAEAAPSASGLK
PFSYNQPGQLFSVQPKVEASSSISTATTNQTWKIMESLKLGPTNPVQTFTMSSVSAPSSS
TTSTAANNEYSTINLPDLHEFFPNISSPMAEESAAPKGSAVAPQTGSTFPLQESQFRVDP
PLVDDEIPDFSNFTDHPVPGTLDSLNMDEFEDLLNPRLMSEGGSAASMLTSSQQGVLSSS
AAASQNGAVSQNLPDHINNPGSTYMNYPNSIANLLRSEDMIVLASSNNNQQPAVLDDFDV
LMSADEDRLISILTAGAKLALCQDTQLNCFSQQRQFVNSFPKDSLINADTIKNPGLKKGR
RG
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggacggtgtgtacggatggggcatgacctctattaacccagtccaaccagcgagccct
tacatagagattatcgagcagccgaagcagagggggatgaggttccgctataaatgtgag
ggtcgctcagctggcagtattcctggagagaaaagcaacgacaccactaagacctacccg
gccatcaaggttcacaactacagcggccctctccgggtccgcatctctctggtgacaaag
aaccctccgcacaaaccccacccccacgaactggttgggaaagactgcaaacatggctac
tatgaggccgacctgcaggagagacgaatccacagttttcagaacctgggcattcagtgt
gtgaagaagaaggatgtcaacgaggccatcacttgcagactgcagaccagcaacaacccc
ttcagcattcctgagcccaaggtgtgggaggaagagtttgacctgaattctgtgcgactt
tgcttccaggcctccatcactcttcccacaggggagatgtttcctctgccgcccgtcgtc
tcacagcctatctttgacaacagagccccaaacacagccgagttgaaaatctgcagagtg
aaccgtaactccggcagctgcagaggaggggatgaaatcttcctcctctgtgataaagtg
caaaaagaggacatcgaagtgcggttcttccaggactcctgggaggggaagggcacgttc
tctcaggctgacgtccaccggcaggtggccattgtcttccgcacacctccctatcgcgac
actaacctcagcgagcccattaaggtgaagatgcagctcagacggccctctgaccgtgaa
gtcagcgagccgatggacttccagttcctacctgctgacccagatgaatacaggctgact
gagaagagaaagcgtacaggagacatgttccagagcttgaagctgggatctatgttatcg
actgtgtccgttccacaagacagacggcacataaacctcgcacggagaccagttgcagct
aaactgtcttcaatgagcacacaagcagcagaggctgccccttctgccagtgggttgaaa
cccttctcatacaatcaaccaggacagctgttctcagtccagcctaaggttgaggcatct
tcgtccatctccacggcgactaccaaccaaacctggaagatcatggagagcttgaagctg
ggccccaccaacccggtgcagaccttcacgatgagctccgtgtcggccccttcgtcctcc
accacctccaccgctgccaacaacgagtactccactatcaacctgccggaccttcacgag
ttcttccccaacatttcctcccccatggccgaggagtctgcggctcctaagggaagtgcc
gtcgccccacagactggcagcaccttccccctgcaggagtcccagttccgggtagacccc
ccactagtggacgacgagatcccggacttctccaacttcaccgaccatccggtgccaggc
accctggacagcctcaacatggatgaatttgaggaccttctgaacccacgcctaatgagc
gagggcggatctgccgcatccatgctgacgtcttcccaacagggagtcctctccagctcg
gctgctgcgtcccagaacggcgccgtatcccagaacctcccagatcacatcaacaaccca
ggaagcacctacatgaattaccccaacagcatcgccaacctgctccggagcgaggacatg
atcgtcctggcgtccagcaacaacaaccagcagcctgccgtgctggatgacttcgacgtg
ctgatgtccgccgatgaagaccgcctcatctccattttaacagcgggagccaagctggct
ttgtgtcaggacacccaacttaattgtttttcccaacaaagacaatttgtaaattccttc
cctaaagactctcttattaatgcagacacaataaagaatcctggactgaaaaagggtcga
agaggctaa

DBGET integrated database retrieval system