KEGG   Poecilia reticulata (guppy): 103472136
Entry
103472136         CDS       T05149                                 

Definition
(RefSeq) tumor necrosis factor-like
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04060  Cytokine-cytokine receptor interaction
pret04150  mTOR signaling pathway
pret04210  Apoptosis
pret04217  Necroptosis
pret04350  TGF-beta signaling pathway
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04625  C-type lectin receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103472136
   04350 TGF-beta signaling pathway
    103472136
   04150 mTOR signaling pathway
    103472136
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103472136
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103472136
   04217 Necroptosis
    103472136
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103472136
   04621 NOD-like receptor signaling pathway
    103472136
   04622 RIG-I-like receptor signaling pathway
    103472136
   04625 C-type lectin receptor signaling pathway
    103472136
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103472136
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103472136
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103472136
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pret04052]
    103472136
   00536 Glycosaminoglycan binding proteins [BR:pret00536]
    103472136
Cytokines and growth factors [BR:pret04052]
 Cytokines
  Tumor necrosis fators
   103472136
Glycosaminoglycan binding proteins [BR:pret00536]
 Heparan sulfate / Heparin
  Cytokines
   103472136
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 103472136
NCBI-ProteinID: XP_008419753
LinkDB
Position
LG11
AA seq 242 aa
MESEFKVLLDADASTGTSDRTSTRIKTFQMSRLALSLISFTLCLATGGAVFLFSNARVKS
AVSDKGNSAFHHALRQISNRAAIHLEGVHDPAINTSVKWMSKVDQAHSQGGLELKDNEIL
IPQNGLYFVYSQASFRISCNSNADDLTSNHMIHLSHTVKRWSRSFGSNDERSYQTLLHSV
RTVCQGTASKDPDSAGSFFSAVYMGAVFDLKSGDRLKTVMEEKMLEKLEEDAGKTYFGVF
AL
NT seq 729 nt   +upstreamnt  +downstreamnt
atggagagtgaattcaaggtattactggatgcagatgccagcacagggacaagtgatcgg
acatccactagaatcaaaacatttcaaatgtccagacttgccttgtccctgatttctttc
actctctgccttgctactggtggtgctgttttcctcttctctaatgctcgtgtcaagagt
gcagtatcagacaagggaaactctgcttttcatcacgccttaaggcaaatttcaaacagg
gcagccattcatctagaaggagtacacgaccccgccataaacacgtcagtgaagtggatg
agcaaagtggaccaggcacactctcaaggaggtctagagctaaaagacaatgagattctg
attcctcagaatggcctctactttgtttacagccaggcgtcgttcagaataagctgcaac
agcaatgctgatgaccttacttccaatcacatgatccatctgagtcacacagtgaaacgc
tggtccagatcatttggctctaatgatgagaggtcctatcagaccctcttgcattcagtt
cgtaccgtgtgccagggtacagccagtaaggatccagactcagctggaagcttcttctct
gcagtgtatatgggagcagtattcgatttaaagagtggggacagactgaagactgttatg
gaagagaagatgcttgagaaacttgaggaagatgcagggaagacttattttggtgtcttt
gccttgtaa

DBGET integrated database retrieval system