KEGG   Poecilia reticulata (guppy): 103472228
Entry
103472228         CDS       T05149                                 

Definition
(RefSeq) pro-neuropeptide Y
  KO
K05232  neuropeptide Y
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04080  Neuroactive ligand-receptor interaction
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103472228
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103472228
SSDB
Motif
Pfam: Hormone_3
Other DBs
NCBI-GeneID: 103472228
NCBI-ProteinID: XP_008419919
LinkDB
Position
LG11
AA seq 99 aa
MHPNLVSWLGTLGFLLWALVCLGALTEGYPVKPENPGEDAPAEELAKYYSALRHYINLIT
RQRYGKRSSPEILDTLVSELLLKESRDTLPQSRYDPSLW
NT seq 300 nt   +upstreamnt  +downstreamnt
atgcatcccaacttggtgagctggctggggacgctggggttcctgctgtgggcgctggtc
tgcctgggcgccttgacggaggggtacccggtgaaaccggagaaccccggggaggacgct
ccggcggaggagttggccaagtattactcagccctgagacactacatcaacctcatcaca
agacagaggtatggaaagaggtccagtcctgagattctggacacactggtctcagagctg
ctgctgaaggagagcagagacacactcccacagtcaagatacgacccgtcgttgtggtga

KEGG   Poecilia reticulata (guppy): 108167040
Entry
108167040         CDS       T05149                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: peptide YY-like
  KO
K05232  neuropeptide Y
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04080  Neuroactive ligand-receptor interaction
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108167040
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108167040
SSDB
Motif
Pfam: Hormone_3
Other DBs
NCBI-GeneID: 108167040
NCBI-ProteinID: XP_017165255
LinkDB
Position
LG16
AA seq 144 aa
MKSAPLPPPLLTLRAHYKRQGNVGDLLQELVNKQXKPQRHFYQTDKRHSDAVMSPTLLAL
CLLVCFLSGRDAYPVKPASPREGAPPEELAKYYSALRHYINLITRQRYGKRDNPDTVFSD
LFVKESSETLPGSNYIRYEGLPGW
NT seq 435 nt   +upstreamnt  +downstreamnt
atgaaatcagcccctctgccaccccctctcctcacgctccgcgctcactataaaagacag
ggcaacgttggggatctgctgcaggagctcgtgaacaagcaangtaaaccacaacggcac
ttttatcaaactgacaagagacactccgacgctgtgatgtcgccaactcttctggctctt
tgcttgctggtatgtttcctctctggcagagacgcttatccagtcaagcctgccagtccc
cgggaaggagctccacctgaggagcttgccaagtattactctgcactgagacattatatc
aatctcattacaagacagaggtatggaaaaagagacaacccagacactgtattttctgac
ctgttcgtgaaagagagctcagaaactcttccaggatccaactacataagatacgaaggg
ctcccggggtggtga

DBGET integrated database retrieval system