KEGG   Poecilia reticulata (guppy): 103472661
Entry
103472661         CDS       T05149                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04060  Cytokine-cytokine receptor interaction
pret04068  FoxO signaling pathway
pret04144  Endocytosis
pret04218  Cellular senescence
pret04350  TGF-beta signaling pathway
pret04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103472661
   04350 TGF-beta signaling pathway
    103472661
   04068 FoxO signaling pathway
    103472661
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103472661
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103472661
  09143 Cell growth and death
   04218 Cellular senescence
    103472661
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103472661
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103472661
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103472661
Protein kinases [BR:pret01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103472661
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal
Other DBs
NCBI-GeneID: 103472661
NCBI-ProteinID: XP_008420644
LinkDB
Position
LG11
AA seq 448 aa
MELLRFSVFCCGAVLLGVVLLPVETNTSAIAIKQLCKFCDLRATNCPGRGVCKVECDITA
ICPEDNEVCVSIWRKKDDNVTFETVCHDPALPLYGLYLDDYNNTKCIMKEKKAKDSKFFI
CSCSNEEECNDHIIFNLNSQVGPVILVSLVPLLVIAIFVITSFYCYRVYSQQQNPRKPLD
NTDKHPIIDNEGSDSSSTHANNLNHNTELLPIELDVLVGKGRFAEVYKAKLKQGSSVREE
HGFETVAVKIFQFEEYASWKNEKDIFSDADLRHENVLHFLTAEERKGQRQYWLITAYHPL
GNLQEYLTNHIISWPDLWLLGSSLARVVAHLHSDRTSCGRCKVPIAHRDIKSSNILVKKD
MTCCLCDFGLALRLDNSLSVDELANSGQVGTARYMAPEVLESRINLENIESFKQADVYSM
ALVLWEIISRCSAIGGKMAGNTGTLRHP
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggagctgcttcggttttccgttttctgctgcggagcggtcctgctcggtgttgtgctt
ctgccggtggagacgaatacctccgcgatcgctataaaacagctgtgcaagttttgtgat
ttgcgggccaccaactgtcccggcaggggagtctgcaaggtggaatgtgacattaccgcc
atctgccccgaagataacgaagtgtgtgtcagcatctggcggaagaaagacgacaatgtt
acgtttgaaacggtttgtcacgatccagctcttcccctgtacggcctgtacctggacgat
tacaacaacacaaagtgcattatgaaggagaaaaaggccaaagactcaaagtttttcatc
tgctcctgttccaacgaggaggagtgcaacgatcacatcattttcaacctaaattctcag
gttgggcccgtcatcctggtcagcctggtgcctcttctggtcatagcaatttttgtcatc
acttcgttctactgttaccgggtctacagtcaacagcaaaacccgcgcaagccactggac
aacaccgacaagcaccccatcatagacaacgagggttcagacagcagctccacgcacgcc
aacaacctgaaccacaacaccgagctcctgcccatcgagctggacgttctggtcggcaag
ggccgctttgccgaggtctacaaagccaagctcaagcaaggctcgtcggtccgggaggag
cacggctttgaaacggtggcagtcaagatcttccagttcgaggagtacgcctcctggaag
aacgagaaggacattttctcagacgcggacctgaggcatgagaacgtgcttcacttcctg
acggccgaggagaggaaggggcagaggcagtactggctgatcacggcttaccacccactg
gggaacctccaagagtacctaaccaatcacatcatctcctggccagacttgtggctgctg
gggagctcgctggcccgtgtggtggcacacctgcacagtgaccgcacttcctgcggccgc
tgcaaggttcccatcgctcacagggacattaaaagctcaaatatactcgtgaaaaaggac
atgacctgctgcctgtgtgactttggcctcgcacttcgactggacaactctctgtctgtg
gacgagctggccaacagcggacaggtgggcacggccaggtacatggctcccgaggtgctg
gagtccagaatcaatctggaaaacatcgagtctttcaaacaggcagacgtttactccatg
gctctggtgctgtgggagatcatctccagatgcagcgcgatcggaggtaagatggcagga
aatacaggaactctcagacacccttag

DBGET integrated database retrieval system