KEGG   Poecilia reticulata (guppy): 103473604
Entry
103473604         CDS       T05149                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 2
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04140  Autophagy - animal
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103473604
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103473604
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103473604
Protein kinases [BR:pret01001]
 Serine/threonine kinases: Other
  CAMKK family
   103473604
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 103473604
NCBI-ProteinID: XP_008422182
UniProt: A0A3P9NNC3
LinkDB
Position
LG12
AA seq 572 aa
MFPCHVTPWPSAESPASCGSYAPSVQQPLPDLLRSCPAPPLNALSQTPSPDPMESLIVVT
EYEPSQPPGEEEVEEMDSSETPEPASSAGAPFRTPSCDLLSHTVGRPEVLLPESQEQRGR
LSLSDRKLSLQERSHTATSPCSSPGLNGRYIYPSLPYSPITSPHSSPRLPRRPTVESHSV
SIIDLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKLLSKKRLLRQAGFPRRP
PPRGTRAVPEGPAQHKGPLERVYQEIAILKKLDHPNVVKLVEVLDDPGEDHLYMVFELVK
QGAVMEVPTDKPFSEEQARFYFRDLLRGIEYLHYQRIIHRDIKPSNLLVGEDGHIKIADF
GVSNQFEGADALLTSTVGTPAFLAPETLSETRKNFSGKALDVWAMGVTLYCFVFGVCPFM
DERILSLHQKIKTQPVVIPECANISDGLKDLLLKMLDKNPEARISVAQIKAHPWVTKNGA
EPLPPQDDNCCLLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNPFDLSRKEDRSG
LCAPAQTFTKQESADGVRSMDLPYVGEDEALS
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgtttccttgtcatgtaactccttggccctctgctgagtctccggcgtcctgcggcagt
tatgcaccgtcagtgcagcaacctctccctgatctgctgcgcagctgtcccgccccgcct
ttaaacgcgctctctcagacaccgtccccagaccccatggagtccctcattgtggtcacg
gagtatgaaccaagtcaaccacccggagaggaagaggtggaagaaatggacagctctgag
acgccggagccagcttcctcagcaggagcacctttccggactccatcctgcgacctgctg
tcccatacagttggtcggcccgaggttctgctgcctgaaagccaagagcaacggggcaga
ttgagtttgtctgaccggaaactttccctgcaagaacgctcacacactgccacctcgccc
tgcagttcgcctggacttaacgggcgctatatttacccgtcgttaccttactctcccatc
acatcgccccactcctccccacgcctgccccgccggcccactgtggagtcccacagcgtt
tccatcatagatctccaggactgcgttcagctcaaccagtacaaactgaaggatgagatt
ggaaagggctcttatggcgttgtcaagcttgcttacaatgaggatgacaacacatactat
gcgatgaagcttctgtccaagaagaggcttctgaggcaggcagggtttccacggagacca
cctcctcgtggaaccagagcggtccccgagggtccagctcagcataaagggccactggaa
cgagtttatcaagagatagccattctaaaaaaacttgaccatcctaatgtagttaaacta
gtagaggttttggatgaccccggcgaggaccatctgtacatggtgtttgagctggtgaag
caaggggctgtgatggaggtgccaactgataaacccttcagcgaggaacaggcccgcttt
tacttcagggatctgctgagaggaatcgagtacttgcattatcagagaatcatccataga
gacatcaaaccctctaacctgttggtgggagaagacggacacatcaagattgcagacttt
ggagttagcaaccagtttgaaggtgccgatgccctgctcactagcacagtgggaacacct
gctttcctcgctcccgaaacactttctgagaccagaaaaaatttctctgggaaggcattg
gatgtctgggctatgggagtaacgctttactgcttcgtctttggagtgtgtccttttatg
gatgagcgcattcttagtctacatcaaaaaatcaaaacccaacctgtggtgataccagaa
tgtgcaaacatatcggatggcctcaaagatttgttgttgaaaatgttggacaagaatcca
gaggccagaatatcagtggcacagataaaggctcatccgtgggtgacgaagaacggtgcc
gagcctcttcctccccaggatgacaactgctgtttgctgattgaggtcactgaggaggaa
gtggagaactctgttaaacacatcccaagcctggctacagtgattttggtgagaaccatg
ttaaggaagcgctcctttgggaatcccttcgacttgagccgaaaggaggatcgcagcggt
ttgtgtgctccagcgcaaacatttacgaaacaagagagcgcagacggagtgagaagcatg
gacctgccctacgtaggagaagacgaggctctttcctga

KEGG   Poecilia reticulata (guppy): 103479439
Entry
103479439         CDS       T05149                                 

Gene name
stk11
Definition
(RefSeq) serine/threonine-protein kinase STK11
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04140  Autophagy - animal
pret04150  mTOR signaling pathway
pret04530  Tight junction
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103479439 (stk11)
   04150 mTOR signaling pathway
    103479439 (stk11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103479439 (stk11)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103479439 (stk11)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103479439 (stk11)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103479439 (stk11)
Protein kinases [BR:pret01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   103479439 (stk11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo APH
Other DBs
NCBI-GeneID: 103479439
NCBI-ProteinID: XP_008432078
UniProt: A0A3P9PXJ4
LinkDB
Position
LG17
AA seq 438 aa
MSDDDLPHLEYLNENELMEMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGK
VKEMLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLQHKNVIQLVDVLYNEEK
QKMYMVMEYCVCGMQEMLDSVPEKRFPVFQAHGYFCQLINGLEYLHSQGIVHKDIKPGNL
LLTTDGSLKISDLGVAEALHPFAEDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAG
VTLYNITTGLYPFEGDNIYKLFENIGKGDYTIPEECGPLLSDLLRGMLEYDPAKRFSIQN
IRQHNWVRKKHPPSERPVPIPASAESRDQWRSMTVVPYLEDLHGYTEDDDDELYDGEDEI
IYTQDFTVPGQVAEEHQDQGNADHSPAVAKPVCVNGTEAGSLNSKTKAERRSSSSSNPSR
KGVSTASKIRKLSTCKQQ
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgagtgacgacgacctgcctcacctcgagtatctcaacgaaaatgaactcatggagatg
gacacgttcatccaccgcattgactctaccgaggtgatctatcagccgcgcaggaagagg
gccaagctgataggaaagtacctgatgggggacctgctgggcgaaggctcttatggcaaa
gtaaaagaaatgctggactcagagacactttgccgcagggctgtcaagatactgaagaag
aagaagcttagacggattcccaatggagaagccaatgttaaaaaggaaattcagctgcta
agaagacttcaacataagaatgtgatccagttagtcgacgtactctacaatgaagagaag
cagaaaatgtatatggtgatggagtattgtgtttgtggaatgcaagaaatgctggacagc
gtcccagagaaaaggtttccagtatttcaagctcacgggtacttctgccaactcataaat
ggccttgaatatttgcacagccagggaatagttcataaagacattaaaccaggaaatctg
ctgctgaccacagacgggtctctgaaaatctccgaccttggagtagcagaggcccttcac
ccgtttgcagaagatgacacgtgtcgtacgagtcagggctcgccggccttccagccccca
gagatcgccaacggactggacaccttttcaggstttaaagtggacatttggtctgctgga
gtaacactatataacattacaacaggtctttatccgtttgagggagacaacatctataag
ctatttgaaaacatcggtaaaggagactacactattcctgaggagtgtgggcccctcctg
tcggacctgctgcgaggaatgcttgagtatgatcctgcaaagaggttttccatacagaat
ataaggcaacacaactgggtgcgaaagaaacatcctccgtcggagcgcccggtgcccatc
cctgccagcgcggagagcagggaccagtggcgcagcatgacggtggttccctacctagag
gatctgcacggctacacggaggacgacgacgacgagctctacgacggagaggatgaaatc
atctacactcaggacttcacagtgccagggcaagtggctgaggaacaccaagatcagggg
aacgcagaccacagcccagctgtcgccaagccagtttgtgtgaatgggacagaagccggg
tctctaaacagcaagaccaaagccgagcgcaggtcctcctcctcgtccaacccctcgcgt
aaaggagtctccacagccagcaaaatccgcaagctctccacctgcaaacagcaatga

DBGET integrated database retrieval system