KEGG   Poecilia reticulata (guppy): 103474682Help
Entry
103474682         CDS       T05149                                 

Definition
(RefSeq) caspase-1-like
Organism
pret  Poecilia reticulata (guppy)
SSDB OrthologParalogGFIT
Motif
Pfam: CARD Death HHH_2 Myb_DNA-binding DUF3458_C
Motif
Other DBs
NCBI-GeneID: 103474682
NCBI-ProteinID: XP_008424032
LinkDB All DBs
Position
LG13
AA seq 232 aa AA seqDB search
MERATAEDGADKKLKRVRDEFVQRVSDAVINQLLDLCLKHGVLGDEEKDSILEGNRTRAN
KARALIDAVTRKGPETCEKVIGYLESKDRMLFKQLGLSSAQASQSAGRRKEEEEETACKR
ARQQDKPDGVTRSQDLSELQLLQVAEQLGKEWKQVAIYLGLESNDVDDLEEAEISVTMRK
QKMLLKWKNKRKRGEATAKHLLESLKEMENLSHKVYEILEGMMSNKRDEADK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggagcgagctacggcggaggacggagctgataagaaacttaaaagagtgagagacgaa
tttgtccaacgagtgtctgatgcagtgattaatcaactcttagatttatgtttaaaacat
ggtgtgttgggtgatgaagagaaagattcaatcctggaggggaaccgcacgcgagctaat
aaggcacgcgctctcattgacgcggtgactagaaaaggacccgagacctgcgagaaggtg
attggttacctggaaagtaaagaccgaatgcttttcaaacagctgggtttgtccagcgct
caggcttcccagtcagctggcagaaggaaagaagaagaagaagaaacggcttgtaaacga
gctcgacaacaggacaagccagatggagtgactcggagccaggacttgtcagagctgcag
cttctgcaggtcgccgagcagcttgggaaggagtggaagcaggtcgccatctacttaggc
ttggaatccaacgacgtggatgacctggaggaagcagagataagtgtaaccatgcggaag
cagaaaatgctgttgaagtggaagaacaaaaggaagcgaggagaagctacagccaaacac
ctgctggagagtctgaaggagatggagaacctgtctcacaaagtttatgagatactggaa
ggaatgatgagcaataagagggatgaagctgataaataa

DBGET integrated database retrieval system