KEGG   Poecilia reticulata (guppy): 103474702Help
Entry
103474702         CDS       T05149                                 

Definition
(RefSeq) histone deacetylase 4-like isoform X2
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103474702
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pret03036]
    103474702
Enzymes [BR:pret01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103474702
Chromosome and associated proteins [BR:pret03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103474702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 103474702
NCBI-ProteinID: XP_008424070
LinkDB All DBs
Position
LG2
AA seq 1113 aa AA seqDB search
MLRTIFEAECSLSPTEGILGKEQSLEVLKTSVLNHIPTVDINSALPLRLPPAAIPMDLRV
DHHHQQQQVSSLSPTGQLSPSSLGGSGGGGGGGGGGGGVVASSVREQQLQQELLALKQKQ
QIQRQILIAEFQRQHEQLSRQHEAQLQEHIKQQQELLALKHQQELLEHQRKMENHRLEQE
LEKQQREQKLQLLKNKERGQESAVASTEVKMRLQEFVLNKKKALAQRSLNQGGLPNDAPY
WYRKTQHSSLDQSSPPQTAVSTYNHPVLGVYNPRDDFPLRKTASEPNLKLRSRLKQKVSE
RRSSPLLRRRDSPITTAKKRSLDMADSACSSAPGSGPSSPNNSSNNIPNENGITVSISNN
MEASLAQRLCXGDQGSINQLSLYTSPSLPNITLGLPATATATAASNVTSAQQDAGLQPAL
SLSPPFLSGGHLSPYLADGGSGGHGAHSPHSPHSPLLQHMVLMDQSPAQSPLVTGVSGMS
MSSASMAKLQRQHRPLGRTQSAPLPQGSAAQAHAQALALQQLVVQQQHQQFLEKHKQQFQ
QQQLHLNKMMGKPGESPVGRQHQSHPEETEEELREHQDAGALPPGVTIKQEPPDPQELQE
LQELQEEALQQHREREQELLFRQQALLLEQQRIHQLRNYQASMEAAGMTMSFPGHRPLSR
AQSSPASASSFPISVPTQDPPAKPRFTTGLVYDSLMQKHQCMCGNTNSHPEHAGRIQSIW
SRLQETGLRAQCECIRGRKATLEELQTVHSEAHVLLYGTNPLRQKLDCSITPMFVRLPCG
GVGVDSDTIWNEVHSSSAARLAVGSVVELVLKVATGELKNGFAVVRPPGHHAEESTPMGF
CYFNSVAIAAKLLQQRLSVSKILIVDWDVHHGNGTQQAFYDDPNVLYVSIHRYDDGNFFP
GSGAPDEVGSGPGVGFNVNVAFTGGLDPPMGDAEYLAAFRSVVMPIADEFAPDIVLVSSG
FDAVEGHPPPLGGYTLTSKCFGYLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVAAL
LGQELDPLPKAVLEQRPNPNAVRSLEKVIETHSKYWCSVHRYSSRLGLSLLEAKRGDSEE
AEAVSAMASLSVANTNTMDQRAEEEPMEEEAPL
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggaccatatttgaagcagaatgttctctttctcccacagagggaatcctgggg
aaggagcagtcgctcgaggtcctcaagacgtcggtgctcaaccacatcccaacagtggac
attaactctgcgctgcccctgcgtctgccccctgctgccatccccatggacctgcgtgtg
gatcaccaccaccagcagcagcaggtgtcgtcgctctccccgacgggccagctctcgccc
agctccctgggaggatctggtggtggcggcggcggtggtggcggcggcggcggtgtggtg
gcgtcctcggtgcgcgagcagcagctgcagcaggagctgctggccctgaagcagaagcag
cagatccagaggcagatcctgatcgctgagttccagcggcagcacgagcagctgtcccgc
cagcatgaggcscagctccaggagcacattaagcagcaacaggagctgctggccctgaag
caccagcaggagctgctggagcaccagaggaagatggagaaccaccggctggagcaggag
ctggagaagcaacagagggagcagaagctgcagctgctgaagaacaaggagcggggccag
gagagtgccgtggccagcaccgaggtgaagatgcgtctgcaggagtttgtcctgaacaaa
aagaaagcgctggcccagcggagcctcaaccagggtggcctccccaacgacgccccctac
tggtaccgaaaaacccagcatagctctctggaccagagctcgcctccacaaaccgcagtg
tccacctacaatcacccggtgctcggcgtctacaaccctcgggacgacttcccgctgcga
aagacagcctcggagcccaacctgaagctgcgttcccggctgaagcagaaagtgagcgag
cggcgcagcagcccgctgctccgccgcagagacagccccatcactacggccaagaagcgt
tccctcgacatggcggactcggcgtgcagcagcgcccccggctccggccccagctcgccg
aacaacagttccaacaacatccccaatgagaacggcatcactgtgtccatctccaacaac
atggaggcatctctggcccagcggctgtgcrgcggcgatcagggctccatcaaccagctg
tccctctacacctcgccgtccctccccaacatcaccctggggctgcccgccactgcyacc
gccaccgccgcctccaacgtgacttccgctcagcaggacgcaggcctgcagccggccctc
tccctcagccctcccttcctgtccggcggccatttgagcccctacctcgcagatggcggg
tccggtggccacggcgcccacagcccccacagcccccacagcccgctgctgcagcacatg
gttctgatggaccagagtcccgctcagagcccgctggtgacaggcgtcagcggcatgtcc
atgtcgtcggcctccatggccaagctgcagcggcagcaccggcccctggggcggacccag
tcggcgccgctgccccaggggagcgccgcccaggcccacgctcaggccctggccctgcag
cagctggtggtgcagcagcagcaccagcagttcctggagaarcacaagcagcagttccag
cagcagcagctccacctcaacaagatgatggggaagcctggcgagtcgcccgtggggcgg
cagcaccagagccacccagaggagacggaggaggagctgagggagcaccaggacgccggg
gccctaccgccgggggtcactatcaagcaggagccgccggacccgcaggagctgcaggag
ctgcaggagctgcaggaggaggcgctgcagcagcaccgcgagcgcgagcaggagctgctc
ttcagacagcaggctttgctgttggagcagcagcggatccaccagctgaggaactaccag
gcgtccatggaggccgccggcatgaccatgtccttccccggacacagacccctgtccagg
gcgcagtcatctccggcctcggcgtcgtccttccccatcagcgtccccacacaggatcct
cccgccaagcctcgcttcaccacaggcctggtgtacgactccctgatgcagaagcaccag
tgcatgtgcggaaacaccaacagccatccggagcatgccgggcgcatccagagcatctgg
tcccggctgcaggagaccggactccgagctcagtgcgagtgtatccgtgggaggaaggcc
actctggaggagctgcagacggtccactccgaagcccacgtcctgctgtacgggaccaac
ccactccggcagaaactcgactgttccataacgcccatgttcgttcggctgccgtgcgga
ggagtgggggtggacagcgacaccatctggaacgaggtccactcgtccagtgcggcgcga
ctcgccgtcggctccgtcgtggagctggtcctcaaagtggcaaccggagagctaaagaac
ggttttgcggtggtccgccctcctggacaccacgccgaggaaagcacccccatgggcttc
tgctacttcaactcggtggccattgcagccaaactgctgcagcagagactcagcgtcagc
aagatcctcattgtggactgggatgttcaccatggcaacggcacccagcaggccttctac
gatgaccctaatgtcctctacgtgtctatccatcgctacgacgatggcaacttttttcca
ggaagtggagcgcccgacgaggtggggagcggtccaggagtgggctttaacgtcaacgtg
gccttcaccgggggcctggacccccccatgggagacgcagagtacctggctgccttcagg
tctgtggtgatgccgatagccgacgagttcgctccggacatcgtgctggtctcctccggc
tttgacgccgtggagggacaccccccaccgctgggcggctacaccctgacctccaaatgt
tttgggtatctgaccagacagctgatgaccctcgctggaggccgggtggtcctggcgttg
gagggaggtcacgacctcaccgccatctgtgacgcctctgaggcctgcgtggctgccctg
ctcggacaggagctggatccgcttccaaaggctgtcctggagcagaggcccaaccccaac
gccgtgcgctctctggagaaagtcatagagactcacagtaagtactggtgctcggtgcat
cgctactcgtcacggctggggctctctctgctggaggccaagcgaggcgactcggaggag
gctgaggccgtcagcgccatggcgtctctgtccgtcgccaacaccaacaccatggatcaa
agggcggaggaggagcccatggaggaggaggctccgctgtaa

DBGET integrated database retrieval system