KEGG   Poecilia reticulata (guppy): 103474898
Entry
103474898         CDS       T05149                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04080  Neuroactive ligand-receptor interaction
pret04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103474898
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103474898
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pret04030]
    103474898
G protein-coupled receptors [BR:pret04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    103474898
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv DUF1634 Claudin_2
Other DBs
NCBI-GeneID: 103474898
NCBI-ProteinID: XP_008424506
LinkDB
Position
LG1
AA seq 365 aa
MSSTTNSITCHYTENVTFFYKNSNKTISDLWRKRDYAVVTLGLLVCFIVIFSNLLVILAI
FKNRRFHFPIYYLLGNLAVSDLFSGLAYLHLMFHTGPWTIKLSPYQWFVRQGLVDTSLTA
SVLNLLAVAMERHQTIFNMQLHSKMSMRRVFIIIFSIWVVSIIMGLFPTMGWNCLCNLKS
CSTMAPLYSRSFLLFWALLNLITFSIMVAIYTRIFFYVRHKSKQMSEHTTPTRHRETVLG
LMKTVSMILGLFVLCWTPGLVLLMLDGLDCESCQVLHYEKYFLVLAECNSFVNPIVYCFR
DKDMRKTFKELLCCLCHRGRGPSDNDFTTLEESRLRTIRKTAEANGLPLMKHVSEDHAAA
SDGFN
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtccagcacaactaatagcattacgtgccactataccgaaaatgtgacttttttttac
aagaatagcaataaaacgatttctgatttatggcgcaaacgggactatgcggtcgtcact
ttggggctgcttgtttgcttcatagttatcttttcaaaccttttggttatattggccatt
ttcaaaaaccgacgctttcacttccccatctactacttgctgggtaatctggctgtttca
gacttgttctcaggccttgcctacctccacttgatgtttcacactggcccttggaccata
aagctaagtccgtaccaatggtttgttcgccaagggctagtcgacaccagcctcacggcc
tccgtcctcaatcttcttgctgttgccatggagcgacaccagaccatcttcaacatgcag
ctgcacagcaagatgagcatgcggcgagttttcatcatcatattttccatctgggtggtg
tcgattattatgggcctttttcccaccatgggatggaactgtctgtgcaacctgaagagt
tgctccaccatggcgccgctctacagtcgcagcttcctgttgttctgggcgcttctcaac
ttgattactttctccataatggtggccatctacacccggatctttttttatgtgaggcac
aagagcaagcagatgtctgagcacacaacgccgaccagacacagagagactgttctcggc
ttgatgaagaccgtttcaatgatcctaggcctcttcgtgctctgctggacaccgggtctc
gttctgctgatgctcgatggtcttgattgcgaaagttgccaagtgctgcactacgagaag
tacttcctggtgctggccgagtgcaattctttcgtcaaccccatcgtctactgtttcaga
gacaaagatatgaggaaaaccttcaaggagcttctgtgctgcttgtgccaccggggtcgg
ggcccgtctgataatgactttaccacgcttgaggagtcgaggcttcgcaccatccggaag
acggcggaggccaacgggttgcctctcatgaagcacgtgtcggaggatcacgccgccgct
tcagacggcttcaactga

DBGET integrated database retrieval system