KEGG   Poecilia reticulata (guppy): 103475142Help
Entry
103475142         CDS       T05149                                 

Gene name
wbscr17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00512  Mucin type O-glycan biosynthesis
pret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103475142 (wbscr17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pret01003]
    103475142 (wbscr17)
Enzymes [BR:pret01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     103475142 (wbscr17)
Glycosyltransferases [BR:pret01003]
 O-Glycan biosynthesis
  Mucin-type
   103475142 (wbscr17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 103475142
NCBI-ProteinID: XP_008424783
LinkDB All DBs
Position
LG13
AA seq 635 aa AA seqDB search
MQPEITPESDSKAADKSSSHRRTAGSGCSSFPAAFRPADVTRRWRVLLLLNVLAVAGFMT
FWAKCNTRSVQAAGPEAPADGRRPGANGTVQGPSVSHEVLLKRLSSLEDVVYRQLNGLSK
SLGLIEGFGGRGKGGLAATLSPLEENDAKYLKEKYGYNAYLSDRISLDRTIPDHRPNKCR
KVSYPRDLPQISLIFIFVNEALSVILRSVHSAVNHTPAHLLKEIILVDDNSDDEQLKGPL
EDYVNKRYPGLVKIVRNQKREGLIRARIEGWKVATAEVTGFFDAHVEFTPSWAEPVLARI
KEDHKRIILPSIDNIKHDTFEVERYENSGHGYNWELWCMYINPPKQWWDEGDMSAPIRTP
AMIGCSFVANRDYFGELGLLDSGMDVYGGENIELGIRVWLCGGSMEVLPCSRVAHIARMK
KPYHSNIAFHTRRNALRVAEVWMDEYKSNVYLAWNIPMENHGIDFGDVSQRVALRKNLQC
KSFQWYLDNVYPEMRRYNNTVLYGEIRNSKVSHLCMDQGMKENHTATLHPCHGWGPQLGR
YTKEGQLFLGPLGSTGDDTRCVVDDQISSFPQLLNCDKVPNAKQKTWSFSQNDSIINRAT
GRCLEVVPANVYFGHLLVLQPCSGQRWTIKNAMKQ
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctgaaataaccccggagtccgacagcaaagcggcggataaatcgtcttctcat
cggcgcactgctggctctggttgctcaagcttccctgcggctttccgtccagctgatgtt
acccgaagatggagggtgttactgctgctcaacgtgctggcggtcgcagggttcatgacc
ttctgggccaagtgcaacacccgcagcgtgcaggcggccggtccggaggctccggctgac
gggaggcggcccggggccaacgggacggtgcaggggcccagcgtgagccacgaggtgctg
ctgaagaggctcagctcgctggaggatgtggtgtaccggcagcttaacggtctgtccaag
tccctgggcctgatcgagggcttcggcggtcgcgggaaaggcggcctggccgccacgctt
tccccgctggaggagaacgacgccaagtacctgaaggagaagtacggctacaacgcctac
ctgagcgacaggatctctctggaccggaccatcccggaccaccggcccaacaaatgtaga
aaagtcagttacccccgagacctcccccagatctccctcatcttcatcttcgtcaacgag
gcgctgtcggtcatcctgcgctccgtccactcggctgtcaatcacacgccggctcacctc
ctcaaagagatcatcctggtggacgacaacagcgacgacgagcagctgaagggaccgctg
gaggattacgtgaacaagcgctaccctggactggtcaagatcgtcagaaaccagaagaga
gaagggctgatccgggccagaatcgagggctggaaggtggcgacggcggaagttaccggg
ttttttgatgcccatgtggagttcactccgtcatgggccgagccggtgctggccagaata
aaagaggaccacaagaggatcatcctgccgtccatcgacaacatcaagcacgataccttc
gaggtggagcgctacgagaactcgggccacggctacaactgggagctgtggtgcatgtac
atcaacccgcccaagcagtggtgggacgagggggacatgtctgcacccatcaggactcct
gccatgattggctgctccttcgtggccaaccgggactactttggggaactcggcctgctg
gactcgggcatggacgtctacggaggggagaacatcgagctgggcatcagggtttggctc
tgcggcggcagcatggaggtgctgccttgctccagagtggctcacattgctcgaatgaag
aaaccttaccacagcaacatcgccttccacacccggcgcaacgctctgcgtgtggcagag
gtctggatggacgaatacaaatccaatgtgtacctggcctggaacatccccatggagaac
cacggcatcgacttcggcgacgtttctcagagagtcgcactgagaaagaatctgcagtgt
aagagcttccagtggtacctggacaatgtttacccggaaatgaggaggtacaacaacacg
gtgctctacggagagatccgtaactccaaagtgagccacctgtgtatggatcagggtatg
aaggaaaaccacacagccacccttcacccctgccatggctggggtcctcagttgggacgc
tacaccaaagagggtcagctgttcctgggtccgctgggcagcaccggagacgacactcgc
tgcgtggtggacgaccagatcagcagctttccccaactcctgaactgtgacaaggtgccc
aacgccaagcagaagacgtggagcttctcccagaacgactccatcataaaccgggccacg
ggtcggtgtctggaggtggtgccggccaacgtttactttggccacctgctggtcctgcag
ccctgctcgggtcagaggtggaccatcaagaacgccatgaagcaatag

DBGET integrated database retrieval system