KEGG   Poecilia reticulata (guppy): 103475366
Entry
103475366         CDS       T05149                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103475366 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103475366 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pret04052]
    103475366 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:pret00536]
    103475366 (fgf1)
Cytokines and growth factors [BR:pret04052]
 Growth factors
  Growth factors (RTK binding)
   103475366 (fgf1)
Glycosaminoglycan binding proteins [BR:pret00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   103475366 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103475366
NCBI-ProteinID: XP_008425158
UniProt: A0A3P9NEJ1
LinkDB
Position
LG14
AA seq 173 aa
MAGCCPSFLNSCFERTPPRPEQSGGEQVDRPLSLQQNQELESLPERRTRVKFYCQNGGYH
LKIAQDGAVSGVREEDDQYIIMKPKAVAIGVIIIQGEQSEKYLSMNDKGELSGKETLNDE
CNFLEHVEPNGYTTFRSQKYSWYVGLKSNGAAMKGPETNQGMKNVLFLPRQAA
NT seq 522 nt   +upstreamnt  +downstreamnt
atggcggggtgctgtccttccttccttaattcatgcttcgagcgaactcctccacgtccc
gagcagagtggtggcgagcaggttgatcgtcctctgtctttrcaacagaaccaggaactt
gaatcgcttccggagagacgcacgagagtcaagttctactgtcagaatggaggatatcac
ctgaagatcgctcaggatggagcggtgtctggcgtgagggaggaagatgaccaatacata
atcatgaagccgaaggcggtggctataggagttattatcatccaaggggagcagtcggaa
aagtacctgtctatgaacgataagggagaactctccggaaaagaaaccttgaatgatgag
tgtaacttcttggaacatgttgaaccaaacggctacaccacatttcgctcccagaaatat
agctggtatgttggtttgaagtcgaatggcgcagctatgaagggaccagaaaccaaccag
ggtatgaagaacgttttattcctgccgaggcaagcagcctga

DBGET integrated database retrieval system