KEGG   Poecilia reticulata (guppy): 103475369
Entry
103475369         CDS       T05149                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103475369 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pret03000]
    103475369 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pret03310]
    103475369 (nr3c1)
Transcription factors [BR:pret03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    103475369 (nr3c1)
Nuclear receptors [BR:pret03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   103475369 (nr3c1)
SSDB
Motif
Pfam: zf-C4 Hormone_recep GCR
Other DBs
NCBI-GeneID: 103475369
NCBI-ProteinID: XP_008425162
LinkDB
Position
LG14
AA seq 764 aa
MDQGGPKHNGNRNDKLTFAGIRPEVGRDSVSTSGLLLQPAMHLPSPGSVNQSTVAPNGQG
GTKDQGELGGLFESDKEGKMSRMHKQEQDIFSYGDSLPLLNQSTSDLDQTSTSVINTSET
SVLGNLPLPDLFPQQIKQEGIFSLDKELGNYGGQAGVGSCSLDGSTAQLIDDADIWQDLD
LPNSLPEISAFELDSEVAHLDTILQESSSGGEKSLLGNGANCIGLNGTEQQQLVQQHQLQ
QQQPPGMLSSVVIKEEKDPDFIHIRTPGVVKQEKQDGASYCQSQCLQSGMSPLHGVGTMP
SAMNVATGSGYHYRGNPGTVGLQDQKPFGTYSNLSGVGESWISGKRYGEASGIQSTSDGL
QSVAALGNFPVGFTSSSARTGESSSTAVTGQSKPGGQAHKICLVCSDEASGCHYGVVTCG
SCKVFFKRAVEGWRARQNTDGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEA
RKNKKLNKIKVQTPSRPSEPASSLPMPIIPRSMPQLVPTMLSVLKAIEPEIIYSGYDSTL
PXXXXXLGSTLSACHFHVFILNRVYVSLSGFRNLHLDDQMTLLQCSWLFLMSFSLGWRSY
EQCNGRMLCFAPDLVINEERMKLPLMGDQCEQMLKICNEFVRLQVSYDEYLCMKVLLLLS
TVPKEGLKSQAVFDEIRMTYIKELGKAIVKREENTSQNWQRFYQLTKLLDSMQEMVEGLL
QICFYTFVNKTLSVEFPEMLTEIITNQIPKFKDGSVKPLLFHQK
NT seq 2295 nt   +upstreamnt  +downstreamnt
atggatcagggtggaccaaagcacaacggtaatcggaacgacaagcttacatttgcaggg
atcagacctgaagtaggcagagattcagtcagcacatctggtttactgcttcaacccgca
atgcatctgcccagtcctgggtctgtgaaccagagcacagtggcaccgaatggacaaggg
ggaaccaaagaccagggggaacttggaggcctctttgagtcagataaggagggtaaaatg
agcagaatgcacaaacaagagcaggatatattcagctatggggacagtttgcctttgttg
aaccagagtacttctgatcttgaccagacgtccacctctgtcattaacacgtcagaaacc
tcagtcctggggaacctccctttgcctgacctgttccctcagcaaattaagcaggagggg
attttctctctggataaggaattaggaaattatggtggacaagcaggtgttggttcttgc
agtctggatgggagcactgctcagctaattgacgatgcagatatctggcaagacctggac
cttccgaactctctgccagaaatcagtgcttttgagttggattcagaggtggcacatttg
gataccatcctccaggagagcagcagcggtggtgaaaagtccctgttgggtaatggggcc
aactgtattggtttgaacggcacagagcagcagcagctggtacagcaacatcagcttcaa
cagcagcagccaccgggaatgctttccagtgttgtcatcaaggaggagaaagatcccgac
ttcatccacatccgtacccctggtgtggtcaaacaggagaagcaggacggtgctagttac
tgccagtcccagtgtctgcagagtggcatgagccctctgcatggggtgggaaccatgccg
tctgccatgaatgttgccacgggaagtgggtaccactacagaggcaatcctgggacagtg
ggcttgcaagaccagaagccttttggcacatactcaaacttgtcaggagtcggggagagc
tggataagcgggaagaggtatggagaagcctctgggattcaaagcaccagtgatggcctt
cagtctgttgcagctttggggaattttcctgtcggctttacaagctcatcagccagaaca
ggagagagcagcagcactgccgtgacaggccagtccaagcccggtgggcaagcccataag
atctgtctggtgtgctcggacgaggcatcaggatgccattacggggtggtgacctgtggc
agctgcaaagtgttcttcaagagggccgttgaaggatggagagcacggcaaaacacagat
ggtcagcacaactacctgtgcgcgggaagaaatgactgcatcattgataagatccgcagg
aagaactgtccagcatgccgcttcaggaaatgtctccaggccggaatgaacctggaagcg
aggaaaaacaagaagctcaacaagattaaagtgcaaacgccrtccaggccctcagaacct
gccagcagyctgcccatgcccatcatacccagaagcatgccgcagctcgtgcccaccatg
ctgtctgtcctgaaggccatcgagcctgagatcatctactcgggctacgacagcacgcta
ccnnnnnnnnnnnnnnttttgggatccactttatctgcctgtcattttcatgtctttata
ttgaacagagtttatgtgtccctttcaggcttccgtaacctgcaccttgatgatcagatg
acgttgctgcagtgctcctggcttttcctcatgtccttcagcctcggctggaggtcctat
gagcagtgtaacggcagaatgctctgttttgctccagatctcgtcataaatgaagagcgc
atgaagctgcctttaatgggtgaccagtgtgagcagatgctgaagatttgcaatgagttt
gtccgactgcaggtgtcctatgatgagtacctctgcatgaaggtcctgttactgctgagt
acagttccaaaagaaggcctgaagagccaggcggtttttgatgagatcaggatgacttac
atcaaggagctgggaaaagccattgtgaagcgagaggagaacacaagtcagaactggcag
cgattctaccagctaactaagctactggactccatgcaggagatggtggagggtctcctg
cagatctgtttctacacctttgtgaataagaccctcagcgtggaattcccagagatgctg
acggagatcatcaccaaccagataccaaaattcaaagacgggagcgtcaaacctctgctg
tttcatcagaagtga

DBGET integrated database retrieval system