KEGG   Poecilia reticulata (guppy): 103475533Help
Entry
103475533         CDS       T05149                                 

Gene name
sod1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pret00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103475533 (sod1)
Enzymes [BR:pret01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103475533 (sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 103475533
NCBI-ProteinID: XP_008425449
LinkDB All DBs
Position
LG14
AA seq 154 aa AA seqDB search
MVLKAVCVLKGAGETTGTVHFEQENESAPVKVTGEIGGLTPGEHGFHVHAFGDNTNGCIS
AGPHYNPFSKNHGGPTDAERHVGDLGNVTAGADNIAKIDIKDSLIKLSGPDSIIGRTMVI
HEKADDLGKGGNEESLKTGNAGGRLACGVIGIAQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcaaagccgtgtgtgtcctaaaaggagctggggagaccactgggacggttcat
tttgagcaggagaatgagtcggctcctgtgaaggttactggagaaatcggtggcctcaca
cctggtgagcatggtttccatgtccatgcttttggagataacacaaatgggtgcatcagt
gcagggccacactacaatcccttttcaaagaaccatggtggtccaactgatgcagaacga
catgttggagacttggggaatgtgactgctggagccgacaatatagccaagattgacatc
aaagacagtttgatcaagctctcagggcccgactccattattggcagaactatggtgatc
catgagaaggctgatgatcttggaaaaggaggaaatgaagaaagccttaagacgggtaac
gctggcgggcgcctggcctgtggagttattggcatcgcccagtaa

DBGET integrated database retrieval system