KEGG   Poecilia reticulata (guppy): 103476790Help
Entry
103476790         CDS       T05149                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00480  Glutathione metabolism
pret00980  Metabolism of xenobiotics by cytochrome P450
pret00982  Drug metabolism - cytochrome P450
pret00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103476790
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103476790
   00982 Drug metabolism - cytochrome P450
    103476790
   00983 Drug metabolism - other enzymes
    103476790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pret02000]
    103476790
Enzymes [BR:pret01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103476790
Transporters [BR:pret02000]
 Other Transporters
  Pores ion channels [TC:1]
   103476790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 Glutaredoxin GST_C_6 UPF0270
Motif
Other DBs
NCBI-GeneID: 103476790
NCBI-ProteinID: XP_008427598
LinkDB All DBs
Position
LG15
AA seq 239 aa AA seqDB search
MATEKCFAKGSPAPGPVPKGRLRLYSMRFCPFAQRTRLVLNAKGIKYDTINIDLQEKPEW
FLEKNPLGLVPALETSAGEIIYESPITCEYLDEVYPEKKLLPSSPFGKAQQRMLLEHFSK
VIPYFYKIPSARRNGEDVSNQEIELKEKFAKLNEHLEKKTTKFFEGDTITMIDYMMWPFF
ERIEVLELKHCLDHTPELKKWTERMLEDPAVKITMFNMDTYKAFYKSVAEGKPDYDLGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggctactgaaaaatgtttcgctaaaggaagccctgcacctggccctgttcccaaaggt
cggctgcgtctctacagcatgagattctgcccttttgctcaaaggaccagattagtgctg
aacgccaaagggatcaaatatgacaccatcaacatcgatttgcaagagaaacctgagtgg
tttcttgaaaagaaccctctcggtcttgtgcctgcactggagacatctgctggtgaaatt
atatacgagtctcccatcacctgcgagtatctggatgaagtgtatcctgagaagaagctt
cttccatcctctccttttggaaaagcccaacaaagaatgctgctggagcatttttccaag
gtaataccttacttctacaagatcccatcagcaaggaggaatggagaggatgtctctaat
caggaaattgagctgaaagagaaatttgctaaattgaatgagcacttggagaagaaaacg
acaaagttctttgaaggtgacaccatcacaatgatcgactacatgatgtggccatttttt
gagaggatcgaggtcttggagctgaagcactgcctggatcacactcctgagctgaagaag
tggactgagcgcatgctggaggatccagctgttaaaatcaccatgttcaatatggacacc
tacaaagccttctacaagagcgtcgctgaggggaaacccgactatgaccttggcctataa

DBGET integrated database retrieval system