KEGG   Poecilia reticulata (guppy): 103476793Help
Entry
103476793         CDS       T05149                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00562  Inositol phosphate metabolism
pret01100  Metabolic pathways
pret04068  FoxO signaling pathway
pret04070  Phosphatidylinositol signaling system
pret04115  p53 signaling pathway
pret04140  Autophagy - animal
pret04150  mTOR signaling pathway
pret04218  Cellular senescence
pret04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103476793
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103476793
   04070 Phosphatidylinositol signaling system
    103476793
   04150 mTOR signaling pathway
    103476793
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103476793
  09143 Cell growth and death
   04115 p53 signaling pathway
    103476793
   04218 Cellular senescence
    103476793
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103476793
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pret01009]
    103476793
Enzymes [BR:pret01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103476793
    3.1.3.48  protein-tyrosine-phosphatase
     103476793
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     103476793
Protein phosphatases and associated proteins [BR:pret01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    103476793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 103476793
NCBI-ProteinID: XP_008427603
LinkDB All DBs
Position
LG15
AA seq 445 aa AA seqDB search
MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFTEAQDALDFYGEVRTRDRKGVTIPSQRRYVYYYNY
LLKNQLEYKPVALLFHKMVFETLPMFSGGTCRDSTVKNRSEPTPQGFKKGNWHWDPQFVV
YQLKVKIHTSNPAHTRREDKHMIFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPDESGEKMENGAVNNVESQQGAPGLGQVQAQVQTQPQGAETRDGCREGDRDYLIL
TLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNSEASTSTSVTPDVSDNEPDHYR
YSDTTDSDPENEPFDEEQHTQITKV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgattataaaagaaatggtcagtcggaacaaaaggagataccaggaggacggt
ttcgacttggacttaacatatatctacccaaacattattgctatgggctttccagcagag
cgactcgaaggcgtgtacagaaacaatatagatgacgtagtacggtttttggattcgaag
cataaaaaccattacaaaatctacaacctctgcgcagaaagacactacgatgctgccaaa
ttcaactgcagagttgcacaataccctttcgaagatcacaacccccctcagctggagcta
attaagccattttgcgaagacttggaccaatggctcagcgaggatgacaatcacgtggcg
gccatccattgcaaggccggcaagggccgcaccggggtcatgatctgcgcctatctgctc
caccgcggcaagttcacggaggcccaggatgcgctcgacttctacggggaagtgaggaca
cgggacaggaagggggtgacaatcccgagccagcgccgatacgtgtactactacaactac
ctgttaaagaaccagctggagtacaagccggtggcgctgctgttccacaagatggtcttc
gagactctccccatgttcagcgggggcacctgcagggacagtaccgttaaaaacaggagc
gagccgacccctcagggcttcaagaaagggaattggcattgggatccgcagtttgtcgta
taccaactcaaagtgaagatccacacgtcgaacccggctcacaccagaagggaggacaag
cacatgatattcgaattcccccagccgctgcccgtttgtggcgacatcaaagtggagttc
ttccacaaacaaaataagatgatgaagaaggacaaaatgttccacttctgggtgaacaca
ttcttcattcctggaccagacgagagcggggaaaagatggagaacggggcggtgaacaac
gtggagagccagcaaggagcgccgggcctgggccaggtccaggcccaggtccagacccag
ccgcagggcgccgagaccagggacggctgcagggaaggcgacagggactacctcatcctg
acgctcacaaagaacgatttagacaaggctaacaaagacaaagccaaccgctacttctca
ccaaacttcaaggtgaaattgtattttacgaaaaccgtggaggagccttcaaactccgag
gctagcacttcgacgtccgtcaccccagacgttagcgacaatgagccagaccattatcga
tactctgacaccactgactctgatccggaaaatgaaccttttgatgaagagcaacacacg
caaatcacaaaagtgtga

DBGET integrated database retrieval system