KEGG   Poecilia reticulata (guppy): 103478006
Entry
103478006         CDS       T05149                                 

Gene name
tnfrsf1a
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04060  Cytokine-cytokine receptor interaction
pret04150  mTOR signaling pathway
pret04210  Apoptosis
pret04217  Necroptosis
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103478006 (tnfrsf1a)
   04150 mTOR signaling pathway
    103478006 (tnfrsf1a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103478006 (tnfrsf1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103478006 (tnfrsf1a)
   04217 Necroptosis
    103478006 (tnfrsf1a)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103478006 (tnfrsf1a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103478006 (tnfrsf1a)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103478006 (tnfrsf1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pret04050]
    103478006 (tnfrsf1a)
   04090 CD molecules [BR:pret04090]
    103478006 (tnfrsf1a)
Cytokine receptors [BR:pret04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103478006 (tnfrsf1a)
CD molecules [BR:pret04090]
 Proteins
  103478006 (tnfrsf1a)
SSDB
Motif
Pfam: TNFR_c6 Death Myc_target_1 stn_TNFRSF12A DUF4924 TMEM192
Other DBs
NCBI-GeneID: 103478006
NCBI-ProteinID: XP_008429662
LinkDB
Position
LG16
AA seq 378 aa
MEGIGNQGRRTFTFLLLMLMSSGVLTIEKPCEPWHYETDGICCNKCHPGFKLVEKCTSNT
ISVCTPCSDGEFSDQINFSPTCRRCRRCKESNNEYQVSPCRNDSNTKCQCKKGYYKHNID
SETYDCLKCKKCGPNEIEVQPCTHETDTVCDCKENFSRETGKCEPCSRCSLKCTQHCTTP
AQTKGPAHPHPQFINMIIGFSVLVVLLVLGILITFIVTKRSFNKKMLSLSSRSSAQQTEQ
SKDFLVSINETSVETSLKEAAETSFVEQELSKLPDCVPMIPDFIYSVLDLVPLQQMKQLV
RSLGVTDTEIEQAEMDNRYCREAHYQMLRVWAQRAPRTVGGGKAETVHRQVLEELLSKLR
QLHLSRAAEELETKYAIQ
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggagggaataggaaaccaaggaagacgtacattcaccttcctgctcctgatgctaatg
agcagtggtgtgttgacgatagagaagccatgtgaaccctggcactatgaaacagatgga
atatgttgcaacaaatgccatcctggttttaaactagtagaaaaatgtaccagcaataca
attagtgtctgcacgccttgtagtgatggtgaattctcagaccagataaacttcagtcct
acctgcagaagatgcagaaggtgcaaagaatcaaacaatgaatatcaggtatcaccatgt
cgaaacgatagcaacactaaatgtcaatgcaaaaaaggctactataaacacaacattgat
tcagaaacatacgactgtttgaaatgtaaaaaatgtggaccgaacgagatcgaagtacag
ccatgtacacatgaaaccgacactgtgtgtgattgcaaggagaacttttccagagagacg
ggcaagtgtgagccctgcagccgttgttctctgaagtgcacacaacactgtacaactcct
gctcagacaaaaggtcctgcccatcctcacccacagtttatcaatatgatcatcggattt
tcagttctggttgttttgctggttttggggattttaatcaccttcatcgtcacaaaacgc
tcgttcaataagaagatgctgagtctgtcctccagatcatctgcccagcaaacggagcag
agcaaggatttcctggtgagtattaatgagacttcagtggaaaccagtctgaaggaggct
gccgaaacctcttttgttgagcaggagttatccaagctgcctgactgtgtcccaatgatc
cccgacttcatctactcagtgctggatctggttcccttgcagcagatgaagcagcttgtt
cgctctctcggcgtcacggacacagagatcgagcaagcagagatggacaacaggtactgc
cgggaggctcactaccagatgctgcgggtctgggcccagagggcgccgcggacagtcgga
ggaggaaaggctgaaactgtacaccggcaggttttggaggagctcttaagcaaactgaga
cagcttcacctgagccgagcagccgaggaactagagacaaagtatgccattcagtga

DBGET integrated database retrieval system