KEGG   Poecilia reticulata (guppy): 103478296Help
Entry
103478296         CDS       T05149                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00020  Citrate cycle (TCA cycle)
pret00190  Oxidative phosphorylation
pret01100  Metabolic pathways
pret01200  Carbon metabolism
Module
pret_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pret_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pret_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103478296 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103478296 (sdha)
Enzymes [BR:pret01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103478296 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 103478296
NCBI-ProteinID: XP_008430258
LinkDB All DBs
Position
LG16
AA seq 663 aa AA seqDB search
MASVRAASRLLSKRVLANTKAVPAAAVQGSRNFHFSIYGKKKSAKVADDISTQYPVVDHE
FDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEQDDWRW
HFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTEEGKIYQRAFGGQSLKYG
KGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECKGVIALCMED
GSIHRFRAQNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIY
GAGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGVGPDK
DHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQV
IDHTNGKDKVIPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALTIAEEHKPGEKL
SPLKPSAGEESVANLDKLRFANGNLRTSEIRLNMQKTMQNHAAVFRTGSVLKEGCDKMAD
VYQSMEKIKTFDRGIVWNTDLVESLELQNLMLNAVQTINGAEQRKESRGAHAREDFKDRI
DEYDYSKPLEGQQKKPFEQHWRKHTMSYVDPKTGKVTLRYRPVIDSSLNEQDCAHVPPAI
RSY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgtacgtgcggcgtcccgtctcctctccaagagggtgctcgctaacacgaaa
gcggtccccgctgctgcagttcagggctccaggaactttcacttctccatctacggcaag
aagaagagcgccaaagtagcagatgatatctccacccagtatcctgttgtggatcacgag
tttgatgccgtggtggtgggagccggaggagctgggcttcgggccgcttttggcctatcg
gaggccggcttcaacacggcctgcgtcaccaagctgttccccaccaggtctcacaccgtc
gctgcacagggtgggatcaacgcggctctgggtaacatggagcaggatgactggcgctgg
catttctacgacactgtgaagggatctgattggctgggagaccaggacgccatccactac
atgacagagcaggctcctgcagccgtagtggagctggaaaacttcggcatgccattcagc
cgcaccgaagaggggaagatctaccagagagccttcgggggtcagagtctcaagtacggg
aaggggggccaggcccaccgctgctgctgtgtggcggaccggacgggacactccctgctg
catacgctttacggaaggtctctccgctatgacaccagctacttcgtggagtactttgct
ctggatctgctgatggaaaacggagagtgtaaaggagttattgctctctgcatggaggac
ggctccatccaccgcttcagagcccagaacaccgtcatcgccacaggtggttacggaagg
acgtatttcagctgcacgtctgcccacaccagcacaggagacggaaccgccatggtgacc
agagccggcctgccgtgccaggatttagagtttgtgcagttccatcccaccgggatctac
ggggctggctgcctgattacggagggttgccgtggcgagggaggaatcctgatcaacagc
gagggcgagcgcttcatggagcgttacgcccccaacgccaaagacctggcctccagagac
gtggtgtcccgctccatgaccatagagatcagagagggcagaggtgtgggtccggacaag
gaccacgtgtacctgcagctccaccacctgcctccgcagcagctggccaccaggctgccc
gggatctctgagaccgccatgatcttcgctggagtcgacgtgactaaggagcccatcccc
gtcctgcccacggttcactacaacatgggaggaattcccaccaactacaagggacaggtg
attgatcacactaacggcaaggacaaagtgattcctgggctgtacgcctgcggtgaggcg
gcttgtgccagcgttcacggcgctaacaggctgggcgctaactcgctgctggacctggtg
gtgttcgggagagcctgcgcgctgaccatcgcagaggagcacaaacctggagagaagctt
tcgcccctgaagcccagcgcaggagaggagtctgtggccaacctggacaagctgaggttt
gctaatggaaatctgagaacatctgagatcaggctgaacatgcagaagactatgcagaac
cacgccgccgtcttccgtaccggctctgttctgaaggagggatgcgataagatggccgac
gtctaccagagcatggagaagatcaaaacgtttgacagaggcatcgtgtggaacacagac
ttggtggagtcactggagctgcagaacctgatgctgaacgccgtccaaaccatcaacggt
gctgagcaaagaaaggagagcaggggtgcgcacgccagagaggacttcaaggatcgtatc
gatgagtacgactactccaagcccctggagggtcagcagaagaagcccttcgagcagcac
tggaggaagcacaccatgtcatacgtagaccccaaaactggaaaggtgacgctgaggtac
cgccccgtcatcgacagctctctgaacgagcaggactgcgcccacgttcctcctgccatc
cgctcgtactga

DBGET integrated database retrieval system