KEGG   Poecilia reticulata (guppy): 103478467Help
Entry
103478467         CDS       T05149                                 

Definition
(RefSeq) trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103478467
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pret01002]
    103478467
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pret04147]
    103478467
Enzymes [BR:pret01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     103478467
Peptidases [BR:pret01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103478467
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103478467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 103478467
NCBI-ProteinID: XP_008430576
LinkDB All DBs
Position
LG16
AA seq 245 aa AA seqDB search
MKYFILLALVAAAYAAPLEDDKIVGGYECRKNSVPYIASLNAGYHFCGGSLITSSWVVSA
AHCYQSRINVRLGEHNIAVNEGTEQFIDSSKVIRHPSYNSYTLDNDIMLIKLGSPAGLNS
YVSTVSLPSSCVGAGTSCLISGWGNTLSSGSNYPDTLRCVDAPVLSDTSCRNSYPGEITS
NMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQANRPGVYTKVCNYNSWIQN
TMASN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacttcattctcttggctcttgttgctgcagcttatgctgctcccctggaggat
gacaagatcgttggtggctacgagtgcaggaagaactctgtgccctacatcgcgtctctg
aacgctggctaccacttctgtggaggctccctgatcactagctcctgggtggtgtccgcc
gctcactgctatcagtctcgcatcaacgtgcgtcttggcgagcacaacatcgctgtcaat
gagggaacagagcagttcatcgactcctcaaaggtcatccgtcaccccagctacaacagc
tacaccctggacaatgacatcatgctgatcaagctgggctcccctgctggcctgaacagc
tacgtgtccaccgtgtccctgccctccagctgtgtcggcgccggcactagctgtctgatc
tctggatggggaaacaccctcagctctggatccaactaccctgatactctgaggtgcgtg
gatgcccccgtcttgagcgacaccagctgcaggaactcctaccctggagagatcacctcc
aacatgatctgcgtcggattcctggagggaggcaaggactcctgccagggtgactctggt
ggccccgtggtctgcaatggtcagcttcagggcattgtgtcctggggttatggctgcgcc
caggcgaacaggcccggtgtctacaccaaggtctgcaactacaacagctggatccaaaac
accatggcctccaactag

DBGET integrated database retrieval system