KEGG   Poecilia reticulata (guppy): 103478519Help
Entry
103478519         CDS       T05149                                 

Gene name
kmt2b
Definition
(RefSeq) histone-lysine N-methyltransferase 2B isoform X1
  KO
K14959  histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103478519 (kmt2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pret03000]
    103478519 (kmt2b)
   03036 Chromosome and associated proteins [BR:pret03036]
    103478519 (kmt2b)
Enzymes [BR:pret01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103478519 (kmt2b)
Transcription factors [BR:pret03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    103478519 (kmt2b)
Chromosome and associated proteins [BR:pret03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103478519 (kmt2b)
   HMT complexes
    MLL3/MLL4 complex
     103478519 (kmt2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET FYRC PHD FYRN zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 PHD_2
Motif
Other DBs
NCBI-GeneID: 103478519
NCBI-ProteinID: XP_008430635
LinkDB All DBs
Position
LG16
AA seq 3882 aa AA seqDB search
MMAAAAGCGSATAAAVGGQGGTATARGRFPGRPWSSRSRLRSEKRWQLGRSSSETDDVTN
GGPRPANLALSLNEDQSHLRLLGIEASHKILGQAGYSSSTSEEGDDFKGFEADKRNAAES
VMSQKNSSKVNAVSTKSRRKSEKPPQKVPAVDEAVPPDPVKEVKAPEEIHDISIETKPAK
DLKKTPKGKNTMDQGSAKSRASAAAPRITIKLVAKKKVKTIKEPQKKADKKLKLKDVQDQ
PDVKDIQGDQILSAHIKLKTESYDDELNTGDKGVPTIPTRRRGRSAVKVAEPVSQTTAKV
VVDDQKSKEKELTKVKDSGSVEQKLNSKDLKKKQVAPLQGSEVKKVTRRSTRVANELSNN
LTDSVPETESLTKPAAVLDELKSEVSQKAEAKPVVRREGRRQSKRLNKDITVPENQGSLA
TESENLLTHASENLPVKTEEMRVPSIKLIKTRNPKYDAQASGKASSRKKKRRKYIWTLAL
VKIGSQTPRAEDTIKVQTETVSQVAKTPPSDTGVKKITKGRGRKSKQECAAPLESMQNVE
KDPQSMPDSETSSVQVQPEADPTPETPTQEITKADCGKVPPLQIKKVSSPGKHKSSKPSF
LIQQVSPVPENKEENLKDPPEVQEDKSSLQDTETTPSRRLRRRTSSLESPQKNSGSNKPA
TTRKRRLRKSPQEEEKPQVEAEVPSQVSTEESAPQILPINSCPNLVEDPPQVTSLNSSEV
LEKESPKAADTPSQTADEVCSQSLENKLEPQIEEAKPLPVPSKPRKPRNNKQAKKKKSVK
KQKAEKAVVLPDTTPDAVPDKVDFINMEPIHMESVEPVAEEVSQVVEERAEPESETKQEP
VLVEEKEKEIQPTVKEEPDMQSIDSQQLGEGQQLGEDQKLGEGQKLGEGQQLGDGQQMGE
DQQLEESQMLGDNEMLGEHQQLLDTEKIVDSQQPVVTSDQTGELISSKKSSRKLKKKRKS
LIGQRQKHRHRGRDGKFAPLKSPEGESTFDTDDDPSLLLAAPVPSPGSTLIGVQKKYKKK
HTSLPFVGSKKSKSQSKIISHLIEMGMEKDNLKQEEADTPVDSGQPDVVSVQPCKSKFVK
NIKHFIMPVVSARSSRVIKTPQRFMDDVGMSVLPRRHSPKKGLQLGLNIRPGKRRDDGAE
RPLSPIFPIDDEDILSEAQLDVDLFSAQDLEDSIDLADSLFFDCKSEKNEKKKPSLKNSS
FKWNLSEDSCEELYTLDKAPESKSENLFLSPPADKLPEPSSDLLDVLKKKSPPKFTKQAA
HLKIYQRLKKPVLGLPKSKITQELEPVSKPALPPVDLAEGLDDEVMSISLRQRDTGADKE
KSKIKIEDLDSPGVVRKVSVSLRSPNSVALKPCTEGALAVKDTALRDSKAPSSVQKSGAV
EGVPLGHIEKGAPQRARLTSANKKMLNLLRKAKVQLIKIDQQKQLKSSGLLSGPAGSRSQ
EIAFKRQRRKQRAQVPRTEVPVKTEQVQGQPQLISPLCQEFRRAGGPRIKHVCRAASVVL
GQPRAMVADDIPRLSALPLHERSGISPSAITKDIGSPSESDSPSLADPKAIKSKKPSSFA
KKKGLGPFGYRSRRCGVCKGCNHEDDCGKCINCLDKPKFGGPNTKRQCCVYKRCDQIEER
KARRLSGRVAPKSSSKRRRSSLSGGYSSNDEGNEGGGDSPSGPNTDGHSPSVRKQPKRVV
KPRVYFDLVDYDSDLDDKALSSSASPARRRGAGPRFNQDFVSLDGFFEDFSDDEVRHRKS
SSHRVPQVRRKPEKALSSQAPLEQTPPSVLAALAHGFEQREVESSKPSHKIRVDFKEDCT
LENVWNMGGLSILTSAPVMPPYVCFLCASKGQHEMLYCQVCCEPFHQFCLEPADRPSEEN
KENWCCRRCKFCHVCGGKNKLSKPLLECDRCQNCYHASCLGPNYPKQNKKRKAWVCTTCI
RCKSCGVTPGKTWDTDWNHDKGLCPDCSNLFDQGNYCPICFKCYEDNDYDSQMMQCGSCN
HWVHAKCEDLTDELYEILSSLPESVVYSCRPCSVTQPSAWRELLYIELRAGVEKVLACLL
SSTLTQHLVTCTQCEKWVDPDSGVENQPACDLRAVGKKFDKGLYTTLKMFHEDVVQVIRK
RLEQEDHLPEEKRPTALARSYYLKLLEEVFNWFNSQDPKLWNLSTKDVPAGMLSTAVHPP
TTEHVYAQWQERKESRPPLGLLQDDNGQQSLDIKEEEAATPTSGDSASQNHFKNSRAAKL
KGKRGRLSKADLDTGWSKDDERQCSLCQKYGDLKPNEAGRLLYLGQNEWAHVNCCLWSAE
VFEEDNGSLLHVHSAVTRGRLMRCERCNQTGATVGCCLTSCQSNYHFMCARSRQCVFQDD
KKVYCHKHRHLITGRMITGQEFEVNRRVYVDFEGISLRRKFLTGLEPELINVMIGSLQID
ELGMLSELSANKGKLFPVGFQCSRWYWSTLNPLRRCRYTCKIREVRPVVPEKPVEEMPDQ
GDNHTIAHSPRQLPECAAQEVEETEAHPPAEESLVPGLPTKSDQGAKPKVPNHPLHRRPA
GGLSRPLPSPGVIQTKPHHILTISDLEETRRARRHSPHSQTPSLRSHMPPPPVASLTGPI
TLRAGKSAHPTSPLFPLGVSDNLMNSTRSVGGRNAPSVRSTSFFPQSHWQDNTASTQQLP
RNRLSFDLSGSDSVEVPHNFLASPEPEDVSPTNGASPHGDLDKNDDQFPYGSFHRDSSMS
LGEEMRTELEIEETLLNEGVAMNCGGQIVVEGDDSEQFWGRTKEVHKRKPLVPNLPRSAA
SAKEDLGSTSSDDDMEHYLNFSRTVVSCPVSKDRSKSPSSSSSTRPLAQLDGIDDGTESD
ASVAATDDAQKVEGPGKNQIQGKTSNSKNPPKIINSSRLANLSFDNKPSEPSVARKSTTD
NPTPRPPLSCDTSSTPSVDRESVLPSPVVESLPNLLTKVPGTSYSEELLSGSSLGFASEA
PLVLEKCEGSSSFTELLPVLQETENQEAETSKVQNSESEGHNLASSAEGSAVLMNHMASN
LLDSAENNQSPMLGLLQPSPFLSTDAQNPSQCLVDSLEVYSCLQDFSQPPLTSITLQPVT
IPQESPSFPCIEPLSAKLTTLTPVEAISQTQLSDPQSDPALPVALGAGSPSETCAALFPT
QTQPFSSATAVSSSGSVSTLPGLQSSAAAPPLQTTSAPVVLNGFSSSSVQKEATPSHTIS
INFSTPRPAIEPHQQVLPQALPGHAILTVKEVGGPNVDPTPHVLLVNRLGQIFVKNPESN
TFQLPTPLSPSFNCVTQIASLLQSNALSATLAAAGSMTAPPAAASVTSVPAPSTPAAQNP
ATVTQLLAHNTNGPVASANSKKSRKNTKTPKDETVSELKKPKKKKESGSSRKSKSSKAAG
QPALSTENVPASPAESAQAIINQAMASNYTPKWSGLRTMSPSSLVLPPGLLIEPEPPVSP
RSPSPPAPPPPVPPPPAPRPRSHVRMKRVSSLSDRIVTKKCKVDFLPPESVSEKEEPRKP
AFPSASSRASGVRIKTPTVKGVLNVDELKDEHMSDSDSSGSEPRSFLSQGEPGKQQAREA
VGHMNLTDWKKYSGSASTSDEEPTPSDDDEGCPTNKDQPHLRFEITSDDGFSVEADSVEV
AWKAVVDGVQEARAIARLRPLTFQKITGARMLGLVHDAIVFLLEQLEGAHRCQRHTFRFF
KQFNQEDDLPVNPTGCARSELYVRKSTFDMFNFLASQHRQLPDIGPYDDEEDEVLLKSTR
RATSLELPMAMRFRHLERTSKEAVGVYRSAIHGRGLFCKRNIEAGEMVIEYAGIVIRSVL
TDKREKYYDGKGIGCYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVINVEGRKHIV
IFALRKIYRGEELTYDYKFPIEDASNKLNCNCGARRCRRFLN
NT seq 11649 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggcggcagcgggatgcggatcagcaaccgcggctgccgtaggaggccaaggt
ggaactgctacggccagaggtcgtttccccggtcggccttggtcttcgcgcagtcgtttg
cgctctgagaagcgatggcaactcgggcgatcaagctcagaaactgatgatgtgactaac
ggagggccaaggcccgcaaacctggctctttcgttaaacgaagaccagtcgcacttgcgt
ctactcgggatagaggcaagccacaagatcctcggccaggctggatatagctctagtaca
agtgaagagggtgatgacttcaaaggatttgaagctgacaaaagaaatgctgcagaatct
gtgatgtcgcaaaaaaattcttccaaagtcaatgctgtcagcacaaaatctaggagaaaa
agtgagaagccaccacaaaaagtgccagcagttgatgaggctgtcccacctgatcctgta
aaagaagtgaaagctccggaggaaatacacgacatatctattgaaacaaaaccagcgaag
gatttgaagaaaactccaaaaggaaaaaacactatggaccaagggtcagccaagagcaga
gcttcagcagcagcaccgaggattacaataaagttggtggccaaaaagaaagtgaaaact
ataaaggagccccagaaaaaggcagataaaaagttgaaattgaaagatgtgcaggaccag
cccgatgttaaggacattcagggtgatcagattttaagcgctcacatcaagttaaaaacc
gaatcttatgacgatgagctcaacactggggacaaaggagtgccgaccatacctacgagg
aggcgtgggagatctgctgttaaggtagcagaacctgtaagtcagactactgccaaagtt
gtggttgatgaccaaaaatcaaaagagaaggaactgaccaaggttaaggacagcggatct
gtagagcagaaactgaactcaaaagacttaaagaaaaagcaagtagccccactgcagggt
tctgaggttaaaaaagtgactcgtagaagcacaagagttgctaacgaactctctaataac
ttaacggacagtgtacctgaaacagaaagtctgactaaacccgctgctgttctggatgag
ctcaagtcagaagtttcacaaaaggctgaggccaaaccagtggtgaggagagaaggtcga
aggcaaagcaaaaggctaaataaagatattacagtgccagaaaaccaaggctcattagcc
acagaatctgaaaacttacttacacatgccagtgaaaatttgcctgttaaaactgaggaa
atgagggtcccaagcataaaattaataaagaccagaaatcctaaatatgatgcacaggcc
agcgggaaagcttcatctcgaaagaaaaaacggagaaaatatatttggactttagcctta
gtcaaaattggaagtcaaaccccacgggcagaagataccatcaaggtacaaacagagact
gtgagccaagtggctaagaccccacctagtgacaccggtgtaaagaagatcacaaaggga
cgaggtagaaaatcaaaacaggaatgtgcagccccactggaaagcatgcaaaatgttgaa
aaggatccccaaagcatgcctgattcggaaacatcaagtgtacaagtgcagcctgaagca
gatcctacgcctgaaactcccactcaagaaatcactaaagcagattgcgggaaggtacca
cctcttcagattaaaaaggtttcatctcctggcaaacataaaagctcaaagccgtctttt
ctgattcagcaggttagcccggtgcctgaaaacaaagaggaaaacctgaaagatccacca
gaggtgcaagaggataagtcttctctacaggacacagagaccactccttctagaaggcta
agaagaaggacgtcaagcctcgagtctccacagaagaattctggcagcaacaaacctgcg
accactcggaaacgaaggctaaggaaaagtccccaagaagaagaaaagccgcaagtggaa
gctgaagttccctctcaggtttctactgaggagtccgctcctcaaattcttccaataaac
tcatgtcctaatttagtcgaagacccaccacaggtgaccagtttaaactcctccgaagtt
cttgaaaaggaaagtccaaaggccgccgacactccctcacaaacagcagatgaagtctgc
tcacagtcattggagaacaaattagaaccacagattgaagaggccaaaccattgcctgtg
ccttccaaacccagaaaacctagaaataataaacaagcaaagaagaagaagtctgttaaa
aagcagaaggctgagaaggctgttgttttgcctgacaccacaccagatgcagtccctgac
aaggttgactttattaacatggagcctattcatatggaaagtgttgagcctgtagctgaa
gaggtgagccaggtagttgaggagagagcagaaccagaatctgagaccaaacaggagcct
gttcttgtagaagaaaaagaaaaggagatacaaccaacggtaaaagaggaaccagacatg
cagtctatagacagtcagcaattgggagaaggtcagcaattgggggaagatcaaaaattg
ggggaaggtcaaaaattgggggaaggtcaacaactgggggatggtcagcaaatgggggaa
gatcagcaattggaggaaagccagatgttgggggacaatgagatgttgggggaacatcag
cagttgttggacactgagaagattgtggacagtcagcagccagtggtcacctcagatcaa
acaggtgaactaatatcatccaagaaatcttccagaaagctaaaaaagaaacgcaaatcc
ttaattggccaacgccaaaagcacaggcacagaggcagagatggaaagtttgcccctctt
aaatcccctgaaggtgaaagtacttttgacactgatgatgacccttctctgctgctggcg
gctcccgtcccatccccagggtctacactcatcggagtacagaaaaagtacaaaaagaag
cacacaagcctgccttttgttggatctaagaagtccaaatcccagtctaaaatcatttcc
cacctgattgaaatgggaatggagaaagataacttgaagcaagaagaagcagacactcca
gtggactcgggacagccggatgttgttagtgttcagccttgcaagtcaaagtttgtaaaa
aacatcaagcacttcattatgcctgttgtaagtgcaagatcctctcgagtgatcaagacc
ccacagaggttcatggatgatgttgggatgtccgtgttgcctcgaaggcactctccgaag
aagggtttgcagcttggcctgaacattcgtccggggaagaggcgagacgatggggcagaa
aggccgttgtctcccatctttccaattgatgacgaggatattttgagtgaagctcagctg
gatgttgatctgttttcagctcaggacctggaggacagcatcgacttggccgatagcctg
ttttttgactgtaagagtgagaaaaatgaaaagaagaagccttccctgaagaactcgagc
ttcaagtggaatctctctgaagattcctgcgaggagttatatacactggataaagcccca
gagagcaaaagtgagaatctgtttttatctcccccagcggataagctcccagaaccatcg
tcggacctcttggacgttctgaaaaagaagagtccacccaaatttaccaagcaggcggct
cacctgaagatttatcagaggctgaagaagcccgttttgggacttccaaaaagcaaaatc
acacaagagctcgagcctgtgagtaaacccgctctgcctccggttgatttagccgaggga
ctcgacgacgaggtcatgagcatcagtctgagacagcgggacacaggcgcagacaaggaa
aagtccaagatcaagatcgaagacctggatagtccaggagtggtgagaaaggtttccgtc
agtcttcggtctcctaattctgttgcattgaagccatgcacagaaggagcattggcagtg
aaagacactgccctgcgggactcaaaagcgccgtcgtcggtacagaagtcaggcgcagtc
gaaggcgttcctcttgggcacatagagaagggagcgccacaaagggcacgcctcactagt
gcaaataaaaaaatgttgaatcttctcaggaaagcaaaggttcaacttattaaaatcgac
cagcagaaacaactcaagtcttctgggctgttatccggtcctgctggctccagatctcaa
gaaatcgcttttaaaagacagaggaggaagcagagggcgcaagttcctcgtaccgaggtt
cctgtcaagaccgagcaagttcaaggacaaccgcagctcatctccccactgtgccaggag
tttcgccgagcaggaggtccgcggatcaagcacgtgtgtcgcgccgcctccgtggtactg
ggccagccccgagccatggtcgccgacgacattccccgactaagtgccttgcctctgcat
gaaagatctggcatctccccatctgctatcactaaagatattgggtctccatcagagtca
gacagcccaagcctggcggatccaaaggcaataaagtcgaaaaaaccgtccagtttcgca
aagaagaaggggctcgggccattcgggtaccgctctcgaaggtgtggcgtttgcaaaggc
tgcaaccacgaagacgactgtgggaagtgcatcaactgtcttgacaagcctaagtttggc
ggccccaacaccaagcggcagtgttgtgtgtataagaggtgtgatcagattgaagagagg
aaagcacgaagactcagtggcagagtggctcctaaaagttcgtctaagcggaggcggtca
tctctcagcggggggtattcaagcaatgatgaagggaacgagggcggcggggactcgcca
tctggtcccaacacagacggccacagtccgtcagtaaggaagcagccaaagcgtgtggtg
aagcctcgagtctattttgacctggtggattatgactctgatctcgacgacaaagcttta
tctagctctgcctcaccagcaaggaggaggggagctggaccgcgcttcaaccaagacttt
gtctccctggatggattcttcgaagacttttcggatgatgaagtcagacaccgtaaatcc
agttcacatcgggtaccgcaggttcgacggaaacctgagaaggctctttcatctcaggct
cccttggagcagactcctcccagtgtcctggctgcccttgctcacggatttgaacagcga
gaagtcgagtcttctaaaccaagtcacaaaatcagagtggactttaaggaggactgtacc
ttggagaacgtctggaatatgggcggtttaagtatattgacctctgcacctgtcatgcct
ccctacgtctgcttcctttgtgccagtaaaggacaacatgagatgttgtactgccaagta
tgctgtgaacccttccaccagttttgccttgaacccgcggatcgcccttcggaggagaat
aaggaaaattggtgctgtaggcgctgcaagttctgccacgtgtgtggagggaagaacaaa
ctctccaagcctttactggagtgtgatcgatgccagaactgttatcatgcttcctgtttg
ggaccgaattatcccaagcaaaacaagaagagaaaggcctgggtttgtacaacttgcatc
cgatgcaaaagctgcggtgtgacaccaggaaagacctgggatactgactggaaccatgac
aagggcctctgtccagactgttcaaacctcttcgaccagggtaattactgtccaatctgc
ttcaagtgttacgaagacaacgactacgatagtcagatgatgcagtgcggctcctgtaac
cactgggtacacgccaagtgtgaggatctaacagacgagctgtacgagatcctgtccagc
cttccagaaagcgtggtgtattcctgccgaccgtgcagcgttacccagcccagcgcctgg
agggagctgctgtacattgagctccgagccggcgtggagaaggtgttggcttgcctgctc
tcctctactctcacccagcacctggtcacatgcactcagtgtgaaaagtgggttgaccct
gacagtggagttgaaaaccagccggcctgtgacctcagagccgtcggcaaaaagtttgac
aaaggcctgtacaccacgctgaaaatgttccacgaagatgtggttcaggtgatacgaaaa
aggctggagcaagaagaccacctcccagaggagaaacgacccacagccctggcgcgctct
tactacctgaagctccttgaagaggtgtttaactggttcaacagccaagacccaaagttg
tggaacctttctaccaaagacgtgccagcagggatgctgtcgacggctgttcaccctccc
acgacagagcatgtttatgcccagtggcaggagaggaaggagtctaggcctccgctgggc
ctccttcaggatgacaacggacagcaaagcttggacataaaggaggaggaggcagctacc
cccacgtcaggggactcggcaagccaaaaccatttcaaaaatagccgagcagccaagctc
aaagggaagagaggtagactttcaaaagctgacttggacacagggtggtcgaaagatgac
gaaaggcagtgctctctgtgccaaaaatatggagacctcaaacccaatgaagctggcagg
ctgctctacctgggccagaatgagtgggcccatgtcaactgctgtttatggtctgctgag
gtatttgaagaagataatggctctctgctgcatgtgcacagcgctgtgacaagggggcga
ttgatgcggtgtgagcgctgtaatcagaccggtgccacagtgggctgctgcctgacgtca
tgtcaaagcaactaccatttcatgtgtgcgcgctcgcggcagtgtgtgttccaggatgat
aaaaaggtctattgccacaaacatcgacatctcatcaccggcaggatgataactggtcaa
gagtttgaagtgaaccgtagagtctatgtggattttgaagggatcagccttcgcagaaag
ttcctgactggattagaacccgaactgatcaatgtgatgattggttctctgcagattgac
gagttgggtatgctgtctgaactgtctgccaacaaaggcaaactgtttcctgtcggtttt
cagtgctctcggtggtactggagtacgttgaaccctctgcgacggtgcagatacacgtgt
aaaattcgggaggtccggcctgtcgtaccagagaagcctgttgaggaaatgcctgaccaa
ggggacaaccacactattgctcacagcccacgtcagctgcctgagtgtgcagcccaagag
gttgaggaaacagaagcccacccccctgcagaggagtctcttgttccaggtcttcccaca
aagtctgatcagggtgcaaaaccaaaagttcccaatcatccccttcatcggaggccagct
ggaggattgtcccgtcctctgccaagcccaggtgtaatccagactaaacctcaccacatc
ctgaccattagtgatctggaagagacacgaagagctcgccgtcacagcccacactcacag
accccgtccctaaggagtcacatgcccccccctcccgtggcttcattaactggacccatt
accctccgtgctgggaaatctgcccaccccacctccccgttgtttccgcttggtgtttca
gataacctgatgaactcaacccgctcagttggaggaagaaacgctccctcggtccgctcc
acttcattcttccctcagtctcactggcaggacaacacagcctccacccagcagttaccc
agaaaccgcctgtcgtttgatctgagtggttcagactcggttgaggtgccgcacaacttt
ttagcttcgccggagcccgaggacgtctctccgaccaacggcgcttcgccccacggagat
ttagacaaaaacgacgaccagttcccctacggctcctttcaccgagattccagtatgagt
ctgggtgaagagatgcggacagaactggagattgaagaaacgcttctgaacgaaggagtg
gctatgaactgcggggggcagatagtggtcgaaggcgacgattcagagcagttttggggg
agaaccaaagaagtacacaagaggaaacccctcgttccaaatcttccacgttctgctgcc
tcagcaaaggaagacctgggaagcacctcttcggatgatgatatggagcactatttaaac
ttctcacgaactgtagtcagctgcccggtgtccaaagatcgatccaagtctccttcctct
tcttcttctacccggcccttggctcagctggacgggatagatgatggtactgagagtgat
gcgagtgtagcagccactgatgatgcccagaaagtcgaaggacccgggaaaaatcagata
caaggaaaaacctctaacagtaaaaatcctcctaaaattattaacagctcaagattagct
aatctgtcatttgacaataagccatcagaaccttcagttgccagaaaaagtacgactgat
aatcccaccccacgtccaccgctgtcctgtgacacctcaagcactccttcagtagatcga
gaatctgtacttccttctccagttgttgagtctcttccaaacttgctcactaaggtgcct
gggacgtcatattcagaggagttgttgtccggttccagtttaggttttgcctctgaggcg
cctcttgtacttgagaaatgcgagggcagctcaagttttaccgaactacttccggttttg
caagaaactgaaaatcaagaggctgaaacctctaaagtccagaactctgagtctgaaggt
cacaacttggcttcctcagctgagggctctgctgttttgatgaaccacatggcgtctaat
ctgctggattcagctgagaataaccagagccccatgctagggctcctccagccctccccg
tttttgtctaccgacgctcaaaacccctcgcagtgtcttgtagattctcttgaggtgtat
tcttgtttacaggatttcagtcaacctcctctgaccagtatcacacttcagcccgtgacg
atacctcaagaatcccccagcttcccgtgcatcgaacctttgtccgctaagctaacgacc
ctcactcctgtagaagctattagccaaacgcagctaagcgaccctcagagtgacccagca
ctaccggtcgcgttaggtgctggttccccatctgaaacctgtgcagctctgtttcccact
caaacacagccattcagttctgccactgctgtctcttcctctggttctgtatcgactctt
cccggcctgcagagttcagccgccgcaccgccgctgcagaccacctccgctcctgtagtc
ctaaacggtttcagctcctcctccgtgcagaaggaagccacgcccagtcacaccatctcc
atcaacttctccactccaaggccagccatcgaaccccaccagcaggtgttgccccaggcg
ttaccgggccacgccatcctcacagtgaaggaggtaggcggtccgaacgtcgatcccact
cctcacgtgctgctggtcaaccgccttgggcagatcttcgtgaagaaccccgagagcaac
accttccagctgcccacccctctctccccgtcatttaactgcgtcacccagatcgccagc
cttttgcagagcaatgctctttcagccacgctggccgcagccgggagcatgacggctccg
ccagccgccgccagcgtgacgtcagtccctgctccctccacgcctgcagctcagaacccg
gccaccgtcacacagctgctcgctcacaacaccaacggccccgtggcctctgcaaattcg
aaaaagtccagaaaaaacacaaaaactccaaaagacgaaacggtctcggagctgaaaaaa
ccaaagaagaagaaagagtcaggttcatccagaaaatccaagtcctccaaggctgcagga
cagcctgccttgtccactgaaaacgtcccggcgagtcctgccgagagcgcccaggccatc
atcaaccaagcgatggcgagcaactacacccccaagtggagcgggctccggacaatgagt
ccatcgtcgctggttttacctcccggccttctaattgaacccgagcctccggtgtcgcca
cgttctccctcaccaccagccccgccgcctccggtgcccccgcctccggcgcctcgccct
cgctctcacgttcgcatgaagagggtgtcttcgctctcggaccgcatcgtcacaaagaag
tgtaaagtcgacttcttaccacctgagagcgtcagtgaaaaggaggagcccaggaagccg
gcttttccaagcgcgtccagcagagcctcgggggtacgcatcaaaaccccgaccgtgaag
ggggtcctgaacgtggatgagctgaaggacgagcacatgagtgattctgatagctctggg
tctgagcccaggagcttcttgtctcagggtgaaccaggaaaacagcaagcaagggaggcg
gtgggtcacatgaacctgaccgactggaagaaatactcaggctctgcttccacatcagat
gaggaaccgacaccatctgatgatgacgagggatgtccaacaaacaaagaccagccacat
ctgcggtttgagattaccagtgacgatggttttagtgtggaggcagacagcgtagaagtg
gcctggaaagcagtggttgatggtgtgcaggaagcccgagcaatcgcaagactccggccc
ctgacttttcagaaaatcacaggggcccgcatgctggggctggtccacgacgccatcgtg
tttttgctggagcaacttgaaggagcccaccgctgtcagcgacatactttccgtttcttc
aaacagttcaaccaggaagacgacctgcccgtcaatccgaccggctgcgcccgctctgag
ctttacgtcaggaagtctacatttgacatgttcaacttcctggcttctcagcacagacag
cttcccgacatcggcccatatgatgatgaggaagatgaagtacttctgaagtccacaaga
cgggctaccagcttggagctgccaatggccatgcgtttcagacacctggaaaggacgtcc
aaggaggcggttggagtctacaggtctgcgatccacgggcgcggtctgttctgcaaaagg
aacatcgaagctggggagatggtcatcgagtatgccggcatcgtcatccgctcggtgctc
accgacaaaagagagaagtactacgacggcaagggcatcggctgctacatgttccgcatc
gacgacttcgacgtggtggacgcgaccatgcacggcaacgcggccaggttcatcaaccac
tcctgcgaacccaactgctactcgcgcgtgatcaacgtggaaggccggaagcacatcgtc
atcttcgcactccgaaaaatctaccggggcgaggaactcacctacgactacaagttcccc
atcgaggacgccagcaacaagctcaactgcaactgcggggcccggcgatgccggcgcttc
ctcaactga

DBGET integrated database retrieval system