KEGG   Poecilia reticulata (guppy): 103478523Help
Entry
103478523         CDS       T05149                                 

Gene name
zbtb32
Definition
(RefSeq) zinc finger and BTB domain-containing protein 32
  KO
K10055  zinc finger and BTB domain-containing protein 16
Organism
pret  Poecilia reticulata (guppy)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pret04121]
    103478523 (zbtb32)
Ubiquitin system [BR:pret04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     103478523 (zbtb32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4
Motif
Other DBs
NCBI-GeneID: 103478523
NCBI-ProteinID: XP_008430640
LinkDB All DBs
Position
LG16
AA seq 504 aa AA seqDB search
MIRINNTQYFHFLQQADVLRQSGSLCDAIISVQSQTFRAHRLVLACASRALAQHLAKGDA
DSPAHCTLEYFSPHTFQQVLDFTYTQALEVPVKDLQQLLRAAQVLEMQLLEDQCRKQLDR
LEAREKDKNREAVDLTEEDRSVEEKDQKQKGRPVSESKVQKTSSPVEKPSFGIVMENASI
ADSADVPTNQKSPKRKAKLSPMSATLCNRDSVITRPNSSGSSFSSAWAFPTNMWDNGNHL
NTLMRIAGNYSNFFASHPLPSSNQTSVVCPFPLSSQHMFPLLSSHFQTPLQSTALGYSRL
HPHPYAQNLYTETSRMGSMIKNGILKRKKLSHTSQTVETSYPKMPKVKERADGCQHCSSR
LLCDPLLRESASTQLGQNCDGCQFCGRDAVQHEANARDHRGEKPYQCKHCPKKFSLKHQL
DTHHRVHTGEKPFECRLCGQRSRDYSAMIKHLRTHGGAAPYQCTVCLEFCSSLVAMQRHV
KSHAVQDFPPDWSINNTYLYISHI
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgatccgaatcaacaacacccaatacttccactttctgcagcaggcagatgtcctccgt
caatcagggtcgctttgcgacgccatcatctcggtgcagagccaaacgtttcgggcgcac
cggttagttctagcctgcgctagtagagcgttagcgcagcacctagccaaaggcgacgca
gacagcccagcccattgcacactggagtatttctctccccacaccttccagcaagtccta
gacttcacctacactcaagctcttgaagtgccggtgaaagacctgcagcagctgctaaga
gccgcccaggtcttagaaatgcagctgctggaggaccagtgccgcaagcagctggaccgc
ctcgaagccagagagaaggataaaaacagagaagcagtagacctcacagaggaagataga
agtgtagaagagaaagatcaaaagcaaaaaggtagaccagtttctgagagcaaagtccaa
aaaacatcctccccggtagaaaagccaagctttggcatcgtcatggaaaatgcttcaatc
gctgattctgcggatgtccccaccaaccaaaaatccccaaaaaggaaggcaaaattgtcc
ccgatgtcagcgaccctgtgcaacagagatagtgtcattaccaggcccaacagcagcggt
tcctccttctcttctgcgtgggcattccctacgaacatgtgggacaatgggaatcacctg
aacaccctaatgcgaattgcagggaactattctaacttttttgcatctcacccccttccg
tcctccaaccagacctctgtggtatgcccattccccctctcttctcaacacatgttccct
ttactcagttcccattttcaaactccccttcagagcacggcactaggctactcacgtttg
cacccccatccctacgctcaaaatctgtacacggagacttcgaggatgggcagcatgatc
aagaatggcattttgaagagaaaaaaattgagccacaccagtcaaactgtggaaacaagc
tatcccaaaatgccgaaagtcaaagaaagagctgacgggtgccaacactgcagttcaaga
ctcctctgtgatccattgctgcgagagtcagcctccacacaattaggtcaaaactgtgat
ggatgtcagttctgcggaagagatgccgtgcaacacgaagcgaatgctagagaccacaga
ggagaaaaaccctaccagtgcaaacactgtccaaagaagtttagcctaaaacatcagctc
gacacacatcaccgcgttcatacgggagagaagccgttcgagtgtcgtctgtgtggtcag
cgctcacgggactactctgccatgatcaaacacctgcggacccatggcggcgcagcgccc
taccagtgcaccgtgtgcctggagttctgcagcagcctggtcgccatgcagaggcacgtc
aagagccacgctgtgcaggacttcccccctgactggagcatcaacaacacctacttgtac
atctcccacatatga

DBGET integrated database retrieval system