KEGG   Poecilia reticulata (guppy): 103478750Help
Entry
103478750         CDS       T05149                                 

Gene name
hdac10
Definition
(RefSeq) histone deacetylase 10
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
pret  Poecilia reticulata (guppy)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pret03036]
    103478750 (hdac10)
Enzymes [BR:pret01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103478750 (hdac10)
Chromosome and associated proteins [BR:pret03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103478750 (hdac10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103478750
NCBI-ProteinID: XP_008430990
LinkDB All DBs
Position
LG16
AA seq 672 aa AA seqDB search
MGTALIYDEEMTKYKLLWVDPACKIEVPERLSVSYEALVRTGLSDRCVSVPPREASDAEI
LLVHSEEYLEGVKKTPHMTLEDLKEFTLQYGDVYFHPNIYHCAKLAAGSALQLVDSVMTG
KVRNGMALVRPPGHHSMRSAASGFCVFNNVAIAARYAKQKHGAKRVLIVDWDIHHGQGVQ
YCFEDDPSVLYFSWHRYEHQEFWPNLRESDYDCVGKGSGAGYNINVPWNEVGMENGDYLS
VFCHVLLPVAYEFCPDLVLVCAGFDSAIGDPEGEMCATPDIFAHLTHLLMNLAGGKLCAV
LEGGYNLTSLAQSVCQTVQTLLGDPLPQLANVRSPCESALESLQCVRSVQRRYWSILKHA
ADSPTTDVSTKRIKLAKAEEEKAETAEEERGQEEKVWPEPAERLRPPVCSASVLPDDAAC
PDGLKRLVSSKDPEPLLVSRIKNRSTEDAGDADGVATFSRLYTLIEKMRTNEIGNGVALV
PDVAAAMECVVQDLGSDLVSRVLVVCVGKEELNCATADGKMLVQISSEDKQEQKGKYYIP
VCLKKGCADTVGFIQAVFGLLLPLGYEYDPGLVLLVRMPGSGVGDCMWQQLIGLLKGFAK
GHTLVLMQTNDGACMDPTASALLGHPAPPLQELLTPLPDDGGALERMRERLQAHWKMLQT
TVSSGNGETAKS
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgggaacagctctgatttatgatgaggagatgaccaaatacaaactgctctgggttgac
ccggcatgtaagatcgaggttcccgagcggctctcggtcagttacgaggccctggtcagg
acgggtctgtctgaccgctgtgtctctgtgccgcctcgtgaggcctcagatgcagagatc
ctgctcgtccacagtgaggaatatctggagggtgtgaaaaagactccgcacatgactttg
gaggacttgaaggagttcacccttcagtacggggacgtctacttccacccaaatatctac
cactgcgccaagctggctgcaggctctgctctgcaactggtggacagtgtcatgacaggg
aaggtcaggaatggcatggctctggttagaccgccgggacaccacagcatgcgcagtgct
gccagtggtttctgtgtgttcaacaatgtggccatagcagcgcgctacgctaagcaaaaa
catggagccaaaagggtgctaatagtagactgggacatacatcacggtcaaggggtgcag
tattgctttgaagatgatccgagtgttctgtacttttcttggcaccgctacgagcatcag
gaattctggcccaatcttagggagtcagactacgattgcgtcggcaaaggaagcggagcc
ggctacaacataaatgtgccatggaatgaggtgggaatggaaaacggcgactatctgtcg
gtcttctgccatgtcctcctgccagtagcttatgagttttgcccagacttagttttggtg
tgtgcaggctttgactcggctattggcgacccagagggagagatgtgtgccactccggac
atcttcgcccacttaactcacctcctaatgaaccttgctggaggaaaactgtgtgctgtg
ctggagggaggctacaacttgacttctctcgcacaatccgtgtgtcagactgttcagact
ttgctcggcgatccgctgcctcagctcgcaaacgtcaggagtccctgcgaaagtgcgctc
gagtctcttcagtgtgtccgatcggttcagaggcggtactggtccatcctgaagcatgca
gccgattcacctacgacagacgtcagcaccaaacggatcaaactggcaaaagcagaggaa
gaaaaagcagagacggcagaggaagaaagaggccaggaggaaaaagtttggcctgagcct
gcagagcgtttgcgtcctcccgtttgttctgcgtcggtgcttcctgacgacgcggcttgt
ccagacggattaaaacgcctcgtctcctccaaagatcccgaaccgcttctagtcagcaga
ataaagaaccgttccacggaagatgcgggtgatgcggatggtgtcgccaccttctcgaga
ctttacaccctgattgagaaaatgagaacaaacgagattggcaacggcgtagcgctggtc
cccgatgtcgccgcagccatggagtgtgttgtccaggatctcggctctgacctcgtcagc
cgggttttagttgtttgtgtcggcaaagaggagctgaattgcgccacggctgatgggaaa
atgcttgtacaaatcagcagtgaagacaaacaggaacagaaaggcaaatattatattcca
gtgtgtttaaagaagggttgtgctgacacagtaggattcatccaggcggtctttggtctc
ctcctacctctgggatacgagtatgaccccggtcttgtccttttggttcgcatgccagga
agcggagtgggcgactgtatgtggcagcaactaattggcctgctgaagggcttcgcaaag
ggacacactctggttctgatgcagacgaatgatggggcatgtatggaccctactgcctcc
gccctccttgggcaccctgcgcctcctctgcaggagcttctgactccgctcccagacgat
ggaggtgctttggagagaatgagagagaggctgcaggctcactggaaaatgctgcaaaca
acagtatcttcaggaaatggagagactgctaaaagctga

DBGET integrated database retrieval system