KEGG   Poecilia reticulata (guppy): 103478767
Entry
103478767         CDS       T05149                                 

Gene name
adcy3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00230  Purine metabolism
pret01100  Metabolic pathways
pret04020  Calcium signaling pathway
pret04114  Oocyte meiosis
pret04261  Adrenergic signaling in cardiomyocytes
pret04270  Vascular smooth muscle contraction
pret04371  Apelin signaling pathway
pret04540  Gap junction
pret04912  GnRH signaling pathway
pret04914  Progesterone-mediated oocyte maturation
pret04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103478767 (adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103478767 (adcy3)
   04020 Calcium signaling pathway
    103478767 (adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103478767 (adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103478767 (adcy3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103478767 (adcy3)
   04914 Progesterone-mediated oocyte maturation
    103478767 (adcy3)
   04916 Melanogenesis
    103478767 (adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103478767 (adcy3)
   04270 Vascular smooth muscle contraction
    103478767 (adcy3)
Enzymes [BR:pret01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103478767 (adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA fn3_4 DUF1053
Other DBs
NCBI-GeneID: 103478767
NCBI-ProteinID: XP_008431015
UniProt: A0A3P9PZU9
LinkDB
Position
LG16
AA seq 1121 aa
MPRNQAFSEPEYSVEYSADCSVTLPSDPGQAVGRTHEVTVRNSGSCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYILIMCAVVYTSEKLASVSVATVGLAGDIL
LYLLCRFGLLPDRISRRFVPYSLWVLIALQIFCHLGLNYARFHQASDTVGWQAFFSFSFF
LTLPLRLTPIVLITTVSCGVHTLVLGVTIAQQQQENIHGSALARQLLANIVIYICAITVG
VTSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKEPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPEYRGDHAACSIRMGLAMVDAISYVREKTQTNVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMECLHGEFDVEPGNGGDRCD
YLRERGIETFLVTVPKDPLGRNGISPVKLSVTSSNGNSPLLINTTECNGSMEAACNTPEE
PEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQALKGKH
TNRLSLRFVDPDLEVRYSIEKEKQSGAAFCCSCVVLLFTTVMEALIDPRLIINYITFAVG
EILLFILTICSLAAIFPGVFPKKLVSFSIWIDHTRWARNTWAIAAIFILTMADLLDMLSC
TPGVPASGSTTVAPFSSSSSQSSLGGCLNNPKYYSFIAVLALIATTMLVQVSHMVKLTLM
LLITATTGIVNIYSWKDIFDHYDMVRFQEYSSEMVPSKFTMTVMIFIMMASFYYFSRHVE
KLARTLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDE
IGVMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPKFRYITKIKTIGSTY
MAASGVTSDVNDGYMCMKKEEQSDRERWQHLADLADFALAMKVTLMNINYQSFNNFMLRI
GLNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKEYGFRFVR
RGPIFVKGKGELLTYFLKGRDKQGSFINGSSVTLPHQVVDS
NT seq 3366 nt   +upstreamnt  +downstreamnt
atgcctcgcaatcaagctttttctgaaccagagtactctgtggagtattcggcagactgc
tctgtgacattgccctctgatccggggcaggctgttgggcgaacacacgaggttacagtt
cgaaattctggatcctgcctttgcctgccacggtttatgcgcctgacatttgcaccagag
tcgttggagaatctctaccagacctacttcagaaggcagagacatgaaacacttttggtg
ctggttgtgtttgctgctctttttgatagttacatcctcatcatgtgtgcagtggtttat
acctctgaaaaacttgcatctgtttctgtggcaactgtgggattggcaggagatattctt
ctctacctgctgtgccgctttgggttgttaccagaccggatctcaaggcgttttgtgccc
tattccctctgggtccttatcgcattacagatattttgccacttgggtctaaactacgct
cgtttccaccaggctagtgacacagtgggttggcaggccttcttcagcttttcttttttc
cttactctgcctttgagactaacacccattgtgctcatcactactgtatcctgtggggtt
cacaccctggttcttggagtcaccattgctcagcagcagcaggagaacatccatggctca
gcgctcgccagacagctactggccaacattgtgatctatatttgtgccatcaccgtgggt
gtcacatcgtactacatggctgaccggaagcatcgaaaggcttttctggaagcaagacag
tcactggaggttaaacttaacctagaagagcaaagccagcaacaggaacgtctcctgctc
tccattcttcccaagcacatagctgatgagatgcttcaggatatgaagaaggagcccagt
caaaaagagatgcaacagttcaacaccatgtacatgtacaggcatgaaaatgtcagtatt
ttgtttgcagatattgtgggtttcacccagctgtcgtcatcttgcagtgcccaggagctg
gtgaagctgctcaatgagctctttgctcgctttgacaagctggctgctaaatatcatcaa
ttgaggatcaagatcctgggagactgctactactgcatctgtggacttccagaatacagg
ggagaccatgctgcctgttccatcaggatgggcctggctatggtggatgctatctcgtat
gtccgtgaaaaaacccaaaccaatgttgatatgagggttggagttcacagtggaacagta
cttggaggagtgctaggacagaaacgctggcagtatgatgtttggtctacggatgtcaca
gtagccaacaaaatggaagcaggaggcattccaggacgtgttcacatctcacaaagtacc
atggagtgtcttcatggagagtttgatgtggagccaggaaatggaggcgatcgctgtgac
tacctgagggagcgaggtattgagaccttcctggtgactgtacctaaagatcccctggga
agaaatggaatcagccctgtgaagctgtcagtaacctcttctaatggaaattccccacta
ttaatcaacacaacagagtgtaatggcagcatggaggcagcctgcaacacacctgaagaa
ccagaagagttggacacaagggtagtgaacccatcttttccaaatccacgaaggaggctc
cgactgcgggacctggctgaacgggtgattgatgcccaagagaatgagcaagagctcaat
aagttgcttaatgaggctctgttggagagagaaacagttcaagctctgaagggaaaacac
accaacaggctttctttgaggtttgtggatccagacctagaggttcgttattctattgag
aaggagaagcagagtggtgctgccttctgttgctcctgtgttgttcttctctttactaca
gtaatggaggcactcatagaccccaggctcattataaactacatcacctttgcagtagga
gagattttgctgtttatcctgacaatctgctctcttgcggctatctttccaggagtcttt
cccaaaaagttggtgtctttctcaatctggattgaccacacccgttgggctcgaaatacg
tgggccattgcagctattttcatcttaaccatggcagaccttttagatatgctcagttgt
acacctggagtcccagcttcaggcagcaccacagtggctccgttttcttcctcatcttca
cagtccagccttggaggatgcctgaataatcctaaatattacagctttatagcagtgctt
gcactaatagccactactatgctagttcaggtcagtcacatggtcaagctaaccctgatg
ctacttataacagcaacaactggcatcgttaacatctacagttggaaagacatctttgac
cactacgacatggttcgcttccaagaatacagctcagagatggttccctccaagttcacc
atgacagttatgatcttcattatgatggccagcttctattacttctccagacatgtggag
aagcttgctcgcacgcttttcttatggaagatagaagtccatgagcagaaggagaaagta
tatgaaatgaggcgctggaatgaagctcttgtaacaaacatgttacctgaacacgtggct
cgacacttcctgggttccaagaaaagggatgaggagttgtacagccagtcatacgatgag
attggtgtcatgtttgcctcaattcccaacttctctgacttttacacagaggagagcatc
aataatggtggcattgaatgtctacggtttctcaacgagatcatctcagactttgatagt
ctactggatgagcccaaatttcgctacatcacaaagatcaagaccattgggagcacatac
atggcagcatcaggtgtcacctctgatgtcaatgatggttacatgtgcatgaagaaggaa
gagcagtctgacagagagcgctggcagcacctggcagacttggcagactttgctctggcc
atgaaggtgacactaatgaacatcaactaccagtcattcaacaacttcatgctacgcatt
ggcctgaacaaaggaggagtgctagctggagtgattggtgcccggaaaccccactatgac
atctggggaaacactgtgaatgtggccagtcgtatggagtccacaggagtgatgggaaat
atccaggtagtggaggactgctataatattttgaaggagtatggcttccgctttgtgaga
agaggacccatctttgtaaagggaaaaggagaactgctcacttattttcttaaaggaaga
gacaaacagggctcatttattaatggttcatccgtcactctaccacatcaagtagtagat
agttaa

DBGET integrated database retrieval system