KEGG   Poecilia reticulata (guppy): 103478943Help
Entry
103478943         CDS       T05149                                 

Definition
(RefSeq) glutamate decarboxylase 1-like isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00250  Alanine, aspartate and glutamate metabolism
pret00410  beta-Alanine metabolism
pret00430  Taurine and hypotaurine metabolism
pret00650  Butanoate metabolism
pret01100  Metabolic pathways
Module
pret_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103478943
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103478943
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103478943
   00430 Taurine and hypotaurine metabolism
    103478943
Enzymes [BR:pret01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103478943
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Chlam_OMP3
Motif
Other DBs
NCBI-GeneID: 103478943
NCBI-ProteinID: XP_008431317
LinkDB All DBs
Position
LG17
AA seq 583 aa AA seqDB search
MATSEPRATGEEQDPNAANLRPPSGTYEYAWMHGCTRKLGMKICGFLQKNNSLEERGRLA
GQKNLLSCDNSDRDSRYRRTETDFSNLFARDLLPAKNGEEPTIQFLLEVVEILTNYIKKT
FDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGIRTGHPRFFNQL
SSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREMIGWPGGEGDGLFSPG
GAISNMYSVMIARYKYFPEVKTKGMSAAPRLVLFTSEHSHYSIKKAGAALGFGSDNVILL
STDERGRVIPADLEAKIIDAKQKGYVPLFVNATAGSTVYGAFDPINEIADICEKYNLWLH
VDGAWGGGLLMSRKHRHKLNGVERANSVTWNPHKMMGVPLQCSAILVREKGILAGCNSMC
AGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDKCLDLSQYLY
NKIKNREGFQMVFDGVPQHTNVCFWYIPPSLRGMPDSDERREKLHRVAPKIKAMMMESGT
TMVGYQPQGNKVNFFRMVVSNPAATQSDIDFLIDEIERMGQDL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgtccgaacccagagccaccggggaggagcaggaccccaacgcggctaattta
agacccccgtctggaacctacgagtatgcgtggatgcacggatgcactcggaaactgggg
atgaagatttgcggcttcctgcagaagaacaacagcctggaagagagagggaggctcgcg
ggccagaagaacctgctctcgtgcgacaacagtgacagagactcgcgctaccgccgcaca
gagacagacttctccaacctgttcgcccgagaccttctgccagccaaaaatggagaggag
cccaccatacagtttttgctggaggttgttgaaatccttacaaactacatcaagaaaacc
tttgaccgctccaccaaggtactggacttccaccatcctcaccagctgctggagggcatg
gagggtttcaacctggagctgtctgaccagccggagtcactggagcagatcctggtggac
tgcagggacacgctgaaatacggcatccggacaggccacccacggttcttcaatcagtta
tcgtctggtttggacatcatcgggctcgccggagagtggctcacttccacggcgaacacc
aacatgtttacctacgagattgcaccagtgttcgtgttgatggagcagctgactctgaag
aagatgagagagatgattggctggccaggcggagaaggagacggcctcttttcaccaggg
ggggctatctccaacatgtacagcgtgatgatcgctcgctacaagtattttcctgaggtc
aagacgaagggcatgtctgccgctccccgcctcgtccttttcacatctgaacacagccac
tactctataaagaaggccggagccgctcttggctttgggtccgacaacgtcatcctgctg
agcacagacgaaagagggagagtcatacctgcagacctagaggctaaaatcattgatgcg
aaacaaaagggttacgtgccactgtttgtgaatgccacagccggttccactgtgtatgga
gcctttgatcccatcaacgaaattgctgacatctgtgagaagtacaacctgtggcttcat
gtagatggcgcctggggtggtggtctgctgatgtctaggaagcaccgtcataaactaaat
ggagttgagagggccaactctgtcacttggaacccccacaagatgatgggtgtcccttta
cagtgttctgccatcctagtcagagagaagggaatcctcgcaggctgtaattccatgtgc
gctggctaccttttccaaccagacaaacagtacgacgtcacctacgatacaggcgacaag
gccatccagtgtgggcggcacgttgacatctttaagttctggctcatgtggaaagccaaa
ggcactattggcttcgagcagcacatcgacaaatgtttggacctgtctcagtacctgtac
aacaagatcaagaaccgggagggatttcagatggtttttgatggcgtgcctcagcacaca
aacgtttgcttctggtacatcccacccagcctgagaggaatgcccgacagcgatgagcgg
cgagaaaaactccacagggttgctccaaagatcaaggccatgatgatggagtcggggacc
acaatggtgggttaccaaccccagggcaataaagtcaactttttccgcatggttgtctcc
aatcctgctgccacacagtctgacatcgacttcctgattgacgagattgagaggatgggt
caagacttgtag

DBGET integrated database retrieval system