KEGG   Poecilia reticulata (guppy): 103479496Help
Entry
103479496         CDS       T05149                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret03030  DNA replication
pret03410  Base excision repair
pret03420  Nucleotide excision repair
pret03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pret00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    103479496 (lig1)
   03410 Base excision repair
    103479496 (lig1)
   03420 Nucleotide excision repair
    103479496 (lig1)
   03430 Mismatch repair
    103479496 (lig1)
Enzymes [BR:pret01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103479496 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     103479496 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103479496 (lig1)
DNA replication proteins [BR:pret03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103479496 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103479496 (lig1)
DNA repair and recombination proteins [BR:pret03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103479496 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     103479496 (lig1)
   MMR (mismatch exicision repair)
    Other MMR factors
     103479496 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 103479496
NCBI-ProteinID: XP_008432184
LinkDB All DBs
Position
LG17
AA seq 1002 aa AA seqDB search
MQRSIASFFQPRIKVKDSQKKTADEPVNKPIKSPLKVQNGVQEADSPIKKVAKRSRQILD
SDEDEAPLVKEQGDKGAPAKTEKTDDVFKAVPTPLSPTPAPSTPITLETPETSASSTSSG
SPSSPSSTSTSRIVKRKTARKMFPKRKLDESESRKGESEVAEEQGQQNKRPRLESGVSSA
ENTDEPMEEGAKEEKVEKPVAEANSPDEEVGNEKTEGEKAKKEEEQVEEKISDEKEKKAE
GAEKKNEAKEKTDDEKGASVAKDKVVEKDTKDTGSPKSQMGEKKQKEAKEQKDKELAKKT
PISSFFAPRKAAVKTEKPEKNEGEKKTSAERKSSDEEQKDAKGESTSGETDYNPSRPNYH
PVDHACWKQGQKVPYLAVARTFEKIEEDSGRLRNIETLSNLLRSVLLLSPDDLLCCVYLC
LNQLGPAYLGMELGIGETVLMKAVAQATGRHLDKIKAEAQEKGDLGLVAESSRSNQRTMF
QPASLTAGGVFKKLKEIASMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGL
AEQSVLAALSQAVCLTPPGQGFPPAVIDAGKGMSAESRRAWIEEKNLILKQTYCEMPNYD
VIIPVLLKAGIDQLPKHCKLTPGVPLRPMLAHPTKGVGEVMKRFDEAAFTCEYKYDGERA
QIHILESGEVRIFSRNQEDNTSKYPDIISRLPKVKKDSVVSCVLDTEAVAWDREKKQIQP
FQVLTTRKRKDVDASEIKVQVCVYAFDLLYLNGESLVRQPLCRRRELLRESFTEVEGEFL
FARSIDSHDTDAIAEFLEQSVRDSCEGLMVKTLEKDATYEIAKRSHNWLKLKKDYLDGVG
DTVDLCVIGAYLGKGKRTGTYGGFLLACYDEDNEEFQSVCKIGTGFKDEDLEQHYKFLKE
HILAKPRPYYRVDQSAEPDVWLDAVQVWEVKCADLSLSPVYKAAMGMVDAEKGISLRFPR
FLRIRDDKKPEDATTGAQIADLYKKQQQIQNQGEKADPEDYY
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggagcatcgcatcgttttttcagcccaggatcaaggttaaagacagccagaag
aaaactgcagacgaaccagtgaacaaacccatcaaaagccccttgaaggtgcagaacggc
gtccaggaagcggattcgccgatcaagaaggtcgccaagcgcagccggcaaatactggac
agcgacgaagacgaggcgccgcttgtaaaagaacaaggcgacaaaggagctcccgctaaa
actgagaagacggacgatgtgttcaaggccgttcccaccccgttgtctccaacgccggcc
ccatccacacccataaccctggaaaccccggagacgtcggcctcctcgacgtcgtcaggg
tcgcccagttctcccagttccacctccacgtctagaattgtgaagcgcaaaactgcgagg
aagatgttccccaagaggaagctggatgagagcgagagtcggaaaggggagtccgaggtc
gcggaggagcagggtcagcaaaacaaacgaccccgcctggagagcggtgtcagcagtgca
gagaacaccgatgaacccatggaggagggagcaaaggaagaaaaggttgaaaagccagtg
gctgaggctaacagcccagacgaggaggtggggaacgagaaaacagaaggagagaaggcc
aagaaggaggaggagcaggtagaagaaaagatctctgatgagaaagaaaagaaagctgag
ggggcggaaaagaaaaatgaagcaaaggagaagacggatgatgagaaaggggcctctgtc
gccaaagacaaggtggttgaaaaggacacgaaagacacagggagcccaaaaagtcaaatg
ggagaaaaaaagcagaaagaggcgaaggagcagaaagataaggagctggccaagaaaacc
ccaatcagcagtttctttgctccccgaaaagcagcagttaagacagagaaaccagagaag
aacgaaggagagaaaaagacgagtgcagagaggaagagctccgatgaggaacagaaagac
gcaaaaggtgaatcaacctcaggagagacggactacaatccatccagaccaaactaccat
ccggtggaccacgcctgctggaaacaaggccaaaaagtgccgtacttggcagtggctcgc
acctttgagaaaattgaagaggactctggcaggttgagaaacatcgagacgctgtcgaac
ctgctccgctcggtgctgctgctctctccagacgacctgctgtgctgtgtgtacctgtgt
ctgaaccagctcggccccgcctaccttgggatggagcttggcatcggggagacggtgctg
atgaaagccgtcgctcaagcaaccgggcgacatttggacaaaattaaagcggaggcgcag
gagaaaggagatttgggcctggtggccgagagttcccgtagcaaccagcgcaccatgttc
cagccggccagtctgacagcaggaggcgtgtttaagaaattgaaggaaattgccagcatg
agtgggaactcggccatgaataagaaaatcgacatcatcaaaggcctctttgtggcgtgc
cgcttctccgaggcccgctacatagtcaggtctctggctgggaagctgaggattggcctt
gctgagcagagtgtcctcgccgcgctgagccaggccgtctgcttgaccccgcctggacaa
ggtttccctcctgctgtgattgatgcaggaaagggcatgagcgctgagagcaggcgggcc
tggatcgaagagaagaacctcattctgaaacaaacatactgcgaaatgccaaattatgac
gtcatcatcccagttttactgaaagcaggcatcgaccagctgcccaaacactgcaaactc
actccaggagtcccgctgaggcccatgttggctcaccccaccaagggtgtcggcgaggtg
atgaagaggtttgacgaggcggcgttcacctgcgagtacaaatatgacggagagcgtgca
cagattcacattctggagagcggcgaagttcggattttcagccgcaaccaggaagacaac
accagcaaatacccagatatcatctcccgcctccccaaggtgaagaaggactctgtagtg
tcttgtgttctggacacggaggcggtggcctgggatcgagagaagaaacagatccaaccc
ttccaagtcctcaccactcgtaagagaaaggatgtggacgcctccgagatcaaagtccaa
gtgtgcgtgtatgcctttgacctcctctatctcaacggagagtccctggtgcgacagccg
ctgtgtcggcgtcgggagctgctgagagagagcttcacagaggtggagggagagtttctg
ttcgcccgttccatcgactctcacgacactgacgccatcgcagagttcctggagcagtcc
gtccgagactcctgcgagggcctgatggtgaagactctggagaaggacgcgacctatgag
attgccaagcgttctcacaattggctcaagttaaagaaggactacctggacggtgtgggc
gacacggtggacctctgcgtgatcggtgcctacctgggaaagggaaaacgaacaggcacc
tacggtggcttcctgctggcctgctacgatgaagacaatgaggagtttcagtcagtctgc
aagatcgggacaggctttaaggatgaagatctggagcagcattacaagtttttaaaggag
cacatcctggccaaaccccgcccctactaccgcgtggaccaatcagccgagcccgacgtg
tggctggacgctgtgcaggtttgggaggtgaagtgcgccgacctctcgctgtcacccgtc
tacaaggctgccatgggaatggtggatgcagagaaaggcatttctctgcggttccctcgc
ttccttcgcatcagagacgacaagaagcctgaggatgccaccaccggagctcagatcgcc
gatttgtacaagaagcagcagcagattcagaatcaaggggagaaagctgacccggaggac
tactactga

DBGET integrated database retrieval system