KEGG   Poecilia reticulata (guppy): 103479939Help
Entry
103479939         CDS       T05149                                 

Gene name
pfkp
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00010  Glycolysis / Gluconeogenesis
pret00030  Pentose phosphate pathway
pret00051  Fructose and mannose metabolism
pret00052  Galactose metabolism
pret01100  Metabolic pathways
pret01200  Carbon metabolism
pret01230  Biosynthesis of amino acids
pret03018  RNA degradation
Module
pret_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103479939 (pfkp)
   00030 Pentose phosphate pathway
    103479939 (pfkp)
   00051 Fructose and mannose metabolism
    103479939 (pfkp)
   00052 Galactose metabolism
    103479939 (pfkp)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103479939 (pfkp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pret01009]
    103479939 (pfkp)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pret03019]
    103479939 (pfkp)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103479939 (pfkp)
Protein phosphatases and associated proteins [BR:pret01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103479939 (pfkp)
Messenger RNA biogenesis [BR:pret03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103479939 (pfkp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 103479939
NCBI-ProteinID: XP_008432878
LinkDB All DBs
Position
LG17
AA seq 803 aa AA seqDB search
MAGATGPKRQDTRKFFENLSGAGKCIAVLTSGGDAQGMNGAVRAVVRMGIYVGAKVYFIH
EGYQGMVDGGDYIKEATWESVSSVLQVGGTVIGSARCKEFRSHEGRLKAAHNLVQRGITY
LCVIGGDGSLTGANLFREEWSGLLNELIEQGLIDEEAARSHSRLHIVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPE
MPPEDGWEDNMCQKLSENRADKKRLNIIIVAEGAIDCHNKAITPDYIKDLVVSRLGFDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVLALLEASTDTPACVVSLVGNQAVRLPLMECV
QMTQEVQKAMDEKKFDEAVRLRGRSFENNLSTYRLLASQTARSELQNGEEEKEAGDEEQS
HTSFNVAVMNVGAPAAGMNAAVRSAVRVGITEGHKMFAVSDGFEGFYKGQIKEIKWGDVG
GWTGQGGSLLGTKRTLPATHLDEIAEQMRIHNITALLVIGGFEAYVGLLELSSARDKYPE
FCVPMVMIPATVSNNIPGSDLSIGSDTALNAITDTCDRIKQSASGTKRRVFIIETMGGYC
GYLATVGGLAAGADTVYIYEEPFDIRDLQANVEHLTQKMKTSIQRGLVLRNENCNENFTT
DFIYQLYSEEGRGVFDCRKNILGHMQQGGAPSPFDRNFGTKVAAKAIQWITRTLRESYKE
GRVFTNSEDTACLLGMRRRAMVFQPVAQLREETDFVHRIPKEQWWLKLRPLMKILAKYKT
SYDVSDAGQLEHVTRVRPKENHI
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggccggagcgacgggaccgaagcggcaggacacccggaaattttttgagaatctttct
ggagctgggaaatgcatcgcggtgctgaccagcggcggagatgctcaaggcatgaatgga
gccgtccgggctgtggtccgaatggggatttatgtgggagccaaagtctactttattcac
gaggggtaccaggggatggtagacggtggagactacatcaaagaggcgacgtgggaaagt
gtctccagcgttctgcaagtgggtggaactgtcattggcagtgccaggtgtaaagagttt
cgctcccatgagggcagactaaaagccgctcacaacctggttcagcgcggcatcacctac
ctgtgtgtgatcggtggagacggcagcttgaccggagccaacctgttcagagaagagtgg
agcggccttttgaatgaactcatagagcaagggctcatagatgaagaggcagccagaagt
cattctcggcttcacattgtcgggatggttggctctatcgacaacgacttttgtggcaca
gacatgaccatcggcactgactcagccttgcatcggatcattgaggtggtggatgctatc
atgactacggctcagagtcaccagaggacatttgtgctggaagtcatgggcagacactgc
ggctaccttgctctagtcagtgccctcgcatgtggagcagattgggttttcattccagag
atgcctcctgaagatggctgggaagacaacatgtgtcagaaactgtctgagaaccgtgct
gataagaaaaggctgaacattattattgtagctgagggtgccattgattgccacaacaag
gcaataacccctgattatatcaaggacctggtagtgagccgcctgggttttgacaccagg
gtcaccatcttgggccacgtgcagagaggtgggactccatctgcctttgacaggattttg
gccagtcggatgggcgtggaggcagtgttggcgttactggaggcgtccacagacacacct
gcctgtgtggtgtctctagttggcaaccaggctgttcggctaccgcttatggagtgtgtt
cagatgactcaagaggtgcagaaggccatggatgagaagaaatttgacgaggcggtcaga
ctgcgtggcaggagctttgagaataatctgagcacctacagactgctggcttctcaaact
gctcgctctgaactccaaaatggagaggaagagaaggaggcaggggatgaagagcaatct
catacctcctttaacgtggcggtgatgaacgtcggcgcgccggccgccggtatgaatgcc
gccgtgcgttcagccgtcagggtgggaatcacagaaggccacaaaatgtttgctgtcagc
gacggctttgagggcttctacaaaggacagatcaaggagatcaaatggggagatgttgga
ggctggaccggccagggaggatctctgctggggaccaaacgaactcttccagcaacacat
ctggatgaaattgctgagcagatgaggatccataacatcactgctttacttgttatagga
ggatttgaggcatacgttggattgctggagctctcctcggcacgggacaaataccccgag
ttctgcgtgcccatggttatgatcccagccacagtctccaataacatacctggttcagat
ctcagcattggctcagacacagctctgaatgccattactgacacatgcgatcgcatcaag
cagtctgccagcggcaccaagcggcgggtcttcatcatcgagacgatggggggctactgc
ggctacttggccacggtgggcggtctggctgcgggagccgacaccgtctacatctacgag
gagccgtttgacatccgtgacctgcaggccaacgtcgagcatctgacgcagaaaatgaag
acgagcatccagagaggcttggtgctccgaaatgagaactgcaacgaaaacttcaccact
gacttcatctaccagctgtactctgaagaaggtcgaggcgtgttcgactgcaggaagaac
atcctgggtcacatgcagcagggcggcgctccgtctcccttcgacagaaactttggcacc
aaggtcgcagctaaagccatacagtggatcacacggacgctcagggagtcgtacaaggaa
gggagagtgttcaccaactcagaggacaccgcctgcctgctggggatgcggcgaagggcg
atggtctttcaacctgtagctcagctcagggaagagaccgactttgtccaccggatcccg
aaggagcagtggtggctcaagctccgtcccctcatgaaaatcctggccaagtacaagacg
agttacgacgtgtccgacgccggccagctggaacacgtgacccgggttcggcccaaagag
aaccacatctga

DBGET integrated database retrieval system