KEGG   Poecilia reticulata (guppy): 103480184
Entry
103480184         CDS       T05149                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor p65-like
  KO
K04735  transcription factor p65
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04137  Mitophagy - animal
pret04210  Apoptosis
pret04218  Cellular senescence
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04623  Cytosolic DNA-sensing pathway
pret04625  C-type lectin receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103480184
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103480184
  09143 Cell growth and death
   04210 Apoptosis
    103480184
   04218 Cellular senescence
    103480184
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103480184
   04621 NOD-like receptor signaling pathway
    103480184
   04622 RIG-I-like receptor signaling pathway
    103480184
   04623 Cytosolic DNA-sensing pathway
    103480184
   04625 C-type lectin receptor signaling pathway
    103480184
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103480184
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103480184
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103480184
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pret03000]
    103480184
Transcription factors [BR:pret03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    103480184
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 103480184
NCBI-ProteinID: XP_008433278
LinkDB
Position
LG18
AA seq 662 aa
MDGVYGWGMTSINPVQPASPYIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTYP
AIKVHNYSGPLRVRISLVTKNPPHKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQC
VKKKDVNEAITCRLQTSNNPFSIPEPKVWEEEFDLNSVRLCFQASITLPTGEMFPLPPVV
SQPIFDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTF
SQADVHRQVAIVFRTPPYRDTNLSEPIKVKMQLRRPSDREVSEPMDFQFLPADPDEYRLT
EKRKRTGDMFQSLKLGSMLSTVSVPQDRRHINLARRPVAAKLSSMSTQAAEAAPSASGLK
PFSYNQPGQLFSVQPKVEASSSISTATTNQTWKIMESLKLGPTNPVQTFTMSSVSAPSSS
TTSTAANNEYSTINLPDLHEFFPNISSPMAEESAAPKGSAVAPQTGSTFPLQESQFRVDP
PLVDDEIPDFSNFTDHPVPGTLDSLNMDEFEDLLNPRLMSEGGSAASMLTSSQQGVLSSS
AAASQNGAVSQNLPDHINNPGSTYMNYPNSIANLLRSEDMIVLASSNNNQQPAVLDDFDV
LMSADEDRLISILTAGAKLALCQDTQLNCFSQQRQFVNSFPKDSLINADTIKNPGLKKGR
RG
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggacggtgtgtacggatggggcatgacctctattaacccagtccaaccagcgagccct
tacatagagattatcgagcagccgaagcagagggggatgaggttccgctataaatgtgag
ggtcgctcagctggcagtattcctggagagaaaagcaacgacaccactaagacctacccg
gccatcaaggttcacaactacagcggccctctccgggtccgcatctctctggtgacaaag
aaccctccgcacaaaccccacccccacgaactggttgggaaagactgcaaacatggctac
tatgaggccgacctgcaggagagacgaatccacagttttcagaacctgggcattcagtgt
gtgaagaagaaggatgtcaacgaggccatcacttgcagactgcagaccagcaacaacccc
ttcagcattcctgagcccaaggtgtgggaggaagagtttgacctgaattctgtgcgactt
tgcttccaggcctccatcactcttcccacaggggagatgtttcctctgccgcccgtcgtc
tcacagcctatctttgacaacagagccccaaacacagccgagttgaaaatctgcagagtg
aaccgtaactccggcagctgcagaggaggggatgaaatcttcctcctctgtgataaagtg
caaaaagaggacatcgaagtgcggttcttccaggactcctgggaggggaagggcacgttc
tctcaggctgacgtccaccggcaggtggccattgtcttccgcacacctccctatcgcgac
actaacctcagcgagcccattaaggtgaagatgcagctcagacggccctctgaccgtgaa
gtcagcgagccgatggacttccagttcctacctgctgacccagatgaatacaggctgact
gagaagagaaagcgtacaggagacatgttccagagcttgaagctgggatctatgttatcg
actgtgtccgttccacaagacagacggcacataaacctcgcacggagaccagttgcagct
aaactgtcttcaatgagcacacaagcagcagaggctgccccttctgccagtgggttgaaa
cccttctcatacaatcaaccaggacagctgttctcagtccagcctaaggttgaggcatct
tcgtccatctccacggcgactaccaaccaaacctggaagatcatggagagcttgaagctg
ggccccaccaacccggtgcagaccttcacgatgagctccgtgtcggccccttcgtcctcc
accacctccaccgctgccaacaacgagtactccactatcaacctgccggaccttcacgag
ttcttccccaacatttcctcccccatggccgaggagtctgcggctcctaagggaagtgcc
gtcgccccacagactggcagcaccttccccctgcaggagtcccagttccgggtagacccc
ccactagtggacgacgagatcccggacttctccaacttcaccgaccatccggtgccaggc
accctggacagcctcaacatggatgaatttgaggaccttctgaacccacgcctaatgagc
gagggcggatctgccgcatccatgctgacgtcttcccaacagggagtcctctccagctcg
gctgctgcgtcccagaacggcgccgtatcccagaacctcccagatcacatcaacaaccca
ggaagcacctacatgaattaccccaacagcatcgccaacctgctccggagcgaggacatg
atcgtcctggcgtccagcaacaacaaccagcagcctgccgtgctggatgacttcgacgtg
ctgatgtccgccgatgaagaccgcctcatctccattttaacagcgggagccaagctggct
ttgtgtcaggacacccaacttaattgtttttcccaacaaagacaatttgtaaattccttc
cctaaagactctcttattaatgcagacacaataaagaatcctggactgaaaaagggtcga
agaggctaa

DBGET integrated database retrieval system