KEGG   Poecilia reticulata (guppy): 103480575
Entry
103480575         CDS       T05149                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103480575 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pret04052]
    103480575 (epo)
Cytokines and growth factors [BR:pret04052]
 Cytokines
  CSF and other factors
   103480575 (epo)
SSDB
Motif
Pfam: EPO_TPO Glyco_hydro_127
Other DBs
NCBI-GeneID: 103480575
NCBI-ProteinID: XP_017166031
LinkDB
Position
LG18
AA seq 204 aa
MANRRTYWSNHAEPVRGYADTAMEFPRLFALLLLVLEWTRPGLPSPLRPICDLRVLNHFI
QEARDAEVAMKSCREECGLTEAASVPQTTVNFEDWEKKNAMEQAQEVQTGLWLLQQALSL
LQTSMTNSELNSHIDNVIRNLQSITAVLRSLNFQDYTPPASTVGLEGTWRVSTAAELLQV
HLNFLRGKVRLLLVDAQACQQEAS
NT seq 615 nt   +upstreamnt  +downstreamnt
atggccaatagacggacctattggtcaaaccacgcggagcctgtgaggggctatgcggac
acggctatggaatttcccagactgttcgccttgctgctattagtgttggagtggacccgt
ccaggcctaccgtccccactaaggccaatctgtgacctgagggtcctgaaccatttcatt
caggaagcacgagacgcagaagttgctatgaaatcatgcagagaagaatgcggtctaaca
gaggctgcctctgttccccaaactactgtcaactttgaggactgggaaaagaaaaatgca
atggagcaagctcaggaagtgcagaccggattgtggcttttacaacaggccctcagctta
ctacagacatcgatgacgaactcggaactcaacagccacatagacaacgtcatcagaaac
ctacagagcatcaccgctgtactacgaagcctcaactttcaagattataccccacctgcc
agtaccgtgggactggagggaacatggcgggtttccacagcagcagaactgcttcaggtt
cacctcaacttcctgcgaggcaaagtacgccttcttcttgtggatgcacaggcttgtcag
caagaggccagctga

DBGET integrated database retrieval system