KEGG   Poecilia reticulata (guppy): 103480692
Entry
103480692         CDS       T05149                                 

Gene name
ppargc1a
Definition
(RefSeq) peroxisome proliferator-activated receptor gamma coactivator 1-alpha isoform X1
  KO
K07202  alpha peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04371  Apelin signaling pathway
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103480692 (ppargc1a)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103480692 (ppargc1a)
   04920 Adipocytokine signaling pathway
    103480692 (ppargc1a)
Mitochondrial biogenesis [BR:pret03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    103480692 (ppargc1a)
SSDB
Motif
Pfam: RRM_1 SR-25 AF-4 TFIIA Ndc1_Nup SprA-related
Other DBs
NCBI-GeneID: 103480692
NCBI-ProteinID: XP_008434034
LinkDB
Position
LG18
AA seq 1032 aa
MDGYGRTEDELFSSSCLLNLTWETCYEQCAALVGEDQPLCPDLPELDLSELDVSDLDADS
FLGGLKWYSDQSEIISSQYGNEASNLFEKIDEENEANLLAVLTETLDSIPVDEDGLPSFE
ALADGDVTNASDRSCPSSPDASPHTPEPEEPSLLKKLLLAPANSQLSYNQYTGGKAQNHA
ASSNHRIRPPPAVVKTESPWNGKARGGSGQQNRPVRRPCTELLKYLTATDDILLHTKASD
AKSAWGGPSSRDKSSLGLSASSSSSSPSSSSTSSFSSLSSTSSSSSSTASKKKSAVPSQQ
QQQQQQQQQQQQQQHQHQQSPQQHHQRGESRAAGECIVAGHGAGKWQRCSHDDGVEDSEG
ASVPVGRRTYTCGHARPKQEHGPPNEEGRPPGDVGRLAAARFISDHKGSPFENKTIERTL
SVEIAGTPGLTPPTTPPHKASQENPFKASLKTKLSSCCSSALTCKRARLSELGAGALAPA
PGASAGGPARKGPEQTELYAQLSKASTALPYAIAQRALGGGLEGHCSTGNNKRAAGQDGH
SDHDYCQALAACKMDGGISVVSMATSLEMTFTPGATSTGKVENRHVVECMDSVMSTSFLS
SSCSTSSSSLSHLTKEQKFIPMDGDACRVRGLGERTLPQTTQIPTQGGSAVRDQLQLSAT
SRKPLCDQEIRAELNKHFGPPLQALYTQGEQEREDSSKPNKPTTPQSPEGGGTDFYSQRL
SGSSYLHPGFLSFQDELELDDGRESRFIFPWEGTPLDLLFDCSPRSPSCSPPSTCSPSRG
SVSPPSSLLLSPSRPFCWTSSGSRSRSRSHSGSRSSSSRYRRRSLSSSPDRRPSSWSHHS
SDLNAVRSRLHKSPHPQSRSPLSRRPRYDSYEEYQHERLKREEYRLDYEKREFERAEQRE
KQRQKAIEERRVVYVGRLRSDCSRSELKRRFEVFGEIEECAVNLRDDGDNFGFIMFRYTC
DAFAALENGHTLRRSNEPQFELCFDGQKQLCKSRYTDLDSHSDDFDPTSTKSKYDSMDFD
SLLKEAQCSLRR
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggacggttatggtcggaccgaagatgagctgttctcctcctcctgccttctgaacctc
acctgggagacttgctacgagcagtgtgctgccttggttggtgaagaccagcccctctgc
ccagaccttcctgaacttgacctctcagagctggatgtcagcgacttggatgccgacagc
tttctgggtggccttaaatggtacagcgaccaatcggagatcatttcctctcagtatggg
aatgaagcgtctaatctttttgagaagatagatgaagaaaatgaggccaacttactggca
gtgcttacagagaccctggacagcatcccggtggatgaggacggattgccttcgtttgag
gccctggcagatggggacgtgaccaatgccagtgaccggagctgtccctcctccccagac
gcctcacctcacaccccagagcctgaggagccttctttgctgaagaagctccttctggcg
cctgcaaactcccagctcagctataatcaatacacaggtggcaaggcacagaaccatgca
gccagcagcaaccaccggatcagaccaccacctgccgtcgtcaagacggagagcccctgg
aacggcaaagcaagagggggctccggccaacagaaccgcccggtgaggcgaccttgcact
gagctgctcaaatacctaacagccactgatgacatcctgctacacaccaaagccagcgat
gccaagagcgcctgggggggtcccagtagcagggacaagagtagcctgggtctcagtgcc
tcatcctcgtcctcgtcgccatcctcgtcatccacctcctcgttctcctccctgtcttcc
acttcttcctcctcttcgtccaccgcctccaagaagaagtcggctgtgccatcacaacag
cagcagcaacagcagcagcaacagcagcagcaacagcagcagcatcagcatcagcagtcg
ccgcagcagcatcaccagcgaggtgagagccgggctgcaggcgagtgtattgtggctggt
catggggctgggaagtggcagcgttgctctcacgatgacggggttgaggattcggagggt
gcctctgtccctgttggtcgcagaacctacacctgcggccatgctcgccccaaacaggag
cacgggccacccaatgaagaaggaaggccgccaggcgatgttggccgcctggccgccgct
aggttcattagtgaccacaaaggatcaccctttgagaacaaaaccattgaacgcacatta
agtgtggagattgctggaaccccaggtctgacaccacctaccacgcccccacacaaagcc
agtcaagagaatcctttcaaagcatctctgaaaaccaagttgtcctcgtgttgctcctcg
gccttgacgtgcaaaagagccaggctgagtgagttgggcgccggcgctttggccccggcc
ccaggtgcctcagccgggggccctgccaggaagggtcccgaacagactgagctctatgcg
cagctaagcaaagcatccaccgcccttccttacgccatcgctcaacgtgcactggggggc
ggccttgaggggcactgcagcactggcaacaacaagagggccgctgggcaggatggccac
agcgaccatgactattgccaggcactggctgcttgtaagatggatgggggcatatccgtt
gtttccatggctacatctttggaaatgacattcaccccgggtgccacttccactggcaag
gtggagaacaggcacgtcgtcgaatgtatggactcagtcatgtcaacatcgtttctgtca
tcttcttgttctacatcatcatcctcacttagtcatttgactaaagagcagaaatttatc
cccatggatggagatgcttgccgtgtcaggggcttaggggagcgtacccttccacaaacc
actcagatacccacacaggggggcagtgctgttagggaccaactgcaactttctgccacc
agccggaagcccctgtgcgaccaggaaatcagagcagaactcaacaagcactttggccct
cccctacaagccctctatactcagggtgagcaggagagagaagatagcagtaaaccaaac
aagcctacaaccccccagtcccctgaggggggagggactgacttttactcccagagactg
tccggatccagctacctgcacccagggtttctgtcctttcaagacgagctggagctggat
gatggccgtgagagtcgcttcatctttccatgggagggcacccctctggacctactcttt
gactgctctcctcgttctccctcctgttccccaccatccacttgctccccttcacgaggc
tccgtctccccaccgtcctcccttctcctgtcacctagtcgaccgttctgctggaccagc
agcgggtcccgttcccgttcacggtcccactccggctcccgcagctcctcatcacgatac
cgcaggcgctctctgtccagctcaccagacagacgtccctcctcttggtctcatcacagc
tccgatctgaacgccgtccgctccagactccataagagccctcaccctcagtctcgatct
ccgctcagccgcaggccaaggtacgacagctacgaggagtaccagcacgagaggcttaag
agggaggagtaccgactggattatgagaagcgggagttcgaaagggccgagcagagggag
aagcaaaggcaaaaagccatagaggagagacgggtggtgtacgtggggcgactgaggtcc
gactgcagccgttcagagctgaagcgccgctttgaagtctttggggaaattgaagaatgt
gcagtgaacctgagggacgatggggacaattttggcttcatcatgttccgatacacctgt
gacgcctttgctgcccttgagaacggacacaccctacgcaggtcgaacgagcctcagttt
gagttgtgttttgacggacagaagcagctctgcaaatcacgatacacagacttggactcc
cattcggacgactttgatccgacttccacgaagagcaagtatgactccatggattttgat
agcttgctgaaagaggcccagtgcagcctgagaaggtaa

DBGET integrated database retrieval system