KEGG   Poecilia reticulata (guppy): 103481270Help
Entry
103481270         CDS       T05149                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00052  Galactose metabolism
pret00500  Starch and sucrose metabolism
pret01100  Metabolic pathways
pret04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103481270
   00500 Starch and sucrose metabolism
    103481270
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103481270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pret04147]
    103481270
Enzymes [BR:pret01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103481270
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103481270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103481270
NCBI-ProteinID: XP_008434919
LinkDB All DBs
Position
LG1
AA seq 972 aa AA seqDB search
MVSYKRLNPENVQFSGALLSEEHHRPAQEDVAVPQPDSTSLLPRRLSCSITKVVLILGSL
LLVLFGGWLLHTIYWLRTTSVQAHRPPPPAPGQALGPVLQADMNDTVAAARSKACSAIPE
AWRFDCYPEKAVVVTRELCEARSCCFIPASGSTRGRSRKNGIPWCFYPPDFPSYSLVSSK
NASMGLKGTLVKDVKTYYPGDILTLEMEIRHETDTRLRVRITDPSSSRFEVPLSVPTATK
KAENPEYVVEFSKQPFGLVVKRKSTGTVLLNTTVAPLFYADQFLQFSTALPSQFIYGLGE
HRSTFLHNIQWNTLTMWARDVPPMEQTNLYGVHPFYLAMEDDGDAHGFFLLNSNAMDVAL
QPGPALTWRTIGGILDFYVFLGPDPGSVVQQYVEVIGQPAMPIYWALGYHLCRWGYKTSN
ATWEVVRRMRNYGIPQDVQWNDIDYMDQAKDFTFDPMNFNTLPDLVLDLHAHNQTYVMIM
DPGISSTQPEGSYWPFDEGLKRGVFIKDAEGKTLIGKVWPGLTAFPDFSDEATYEWWYEN
LQRFHEKVPFDGLWIDMNEPSNFLDGSTVGCPSNSLENPPYTPGVLGGLLRSKTVCASAQ
QKLSTHYNLHSLYGLMEAKATASALKRILAKRPFVISRSTFPSHGSYSGHWLGDNRSHWK
DLYTSIAGMLTFNLLGIPLVGADICGFSEEPQEELCVRWTQLGAFYPFARNHNSLDMTPQ
DPTAFSPSARTAMKQALLLRYSFFPFLYTLFHHAHVKGHTVARPLMFEFPKDVKTYGIDS
QFLWGRSLLVTPVLEPGVDYVVGYFPEGLWYDFYTGDSVSSKGEELRLSAPMDKINLHLR
QGSIIPTQEPNVTLWISSGQPLHLVSALSDDGSASGDLFWDDGETIDTYETERYTYVVFS
VSQNTMTSSVLHSDQEGSFLSIDSASFYGVKQKPSAVLVNSHKFPFIYRDNQVLSVASLG
LRLTQNFTISWM
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcttataagaggctgaatccagaaaacgttcagttttctggtgcacttttatca
gaagagcatcatcgtccagctcaggaagatgtggccgtgccacagccagacagcacctct
ctgctccccagaaggctgtcatgctcaatcaccaaagttgtgctgatactcggcagcctg
ctgctggtcctgttcgggggctggttgctgcacaccatatactggctgcgcaccacatcc
gtccaggcgcacaggccaccgccgccagcgccagggcaggctctaggccccgtgttacaa
gcggacatgaatgacactgtggccgctgcacgttccaaagcttgcagtgctatcccagag
gcgtggaggttcgattgctaccccgagaaagcggtggttgtgacccgggagctgtgtgag
gccaggagctgctgcttcatccctgcttctggttcaactagaggcagatctaggaaaaac
ggtatcccgtggtgtttctatcctcctgacttcccctcatactccttggtgtcatcaaaa
aacgcgtcgatgggactcaaaggtaccctggtaaaagatgtgaagacttactaccctgga
gacattctcactctagagatggagataagacacgaaacggacacacgcctgcgtgtcagg
ataacagacccctccagctcacgctttgaggtcccactctctgtccccactgccaccaag
aaagcagaaaaccccgaatacgtcgtagagttttcaaagcagccttttggcctcgtggtg
aagaggaagtctacaggaactgtgctcctgaacaccacagtggcgccgctcttctacgct
gatcagttcctccagttctccaccgccctgcccagtcagttcatttatggcctgggtgaa
caccgctccacctttctgcacaacatccagtggaacacactcaccatgtgggccagggat
gttcctcccatggaacagacgaacctctacggtgttcatccattttatctggcgatggag
gacgatggggatgcacacggcttcttcctcctgaacagcaacgccatggatgtggccctc
cagccaggccctgccctcacctggcgtaccatcggaggaatcctggacttctacgtgttc
ctcggtccggatcctgggtcagtcgttcagcagtacgtggaggtcataggacagccagcc
atgccaatctactgggccttagggtaccacctctgtcgctggggctacaagaccagcaat
gccacctgggaagttgtcaggagaatgaggaattatgggataccgcaggacgtccagtgg
aatgacatcgactacatggaccaagccaaagacttcacctttgacccgatgaacttcaac
actcttccggacttggtgctggacctccacgctcacaaccagacctacgttatgataatg
gacccaggaatcagcagcacacagccggagggctcctactggcccttcgacgagggacta
aagcgaggagtcttcatcaaggacgctgaagggaagactctaattgggaaggtgtggcct
ggtctgacagcatttccagacttctcagatgaggcgacgtatgaatggtggtatgaaaac
ctgcaaaggtttcatgagaaggtcccatttgatggattgtggattgacatgaacgagcca
tcaaacttcctggacggatctactgttggctgtccgtcaaacagtctggaaaatcctcct
tacacaccaggtgtgctgggaggtttgctcagatctaaaactgtatgcgcctctgcacag
cagaaactgtcaacacattataacctgcacagtctctatggactcatggaagctaaagcc
actgcaagtgctctgaagaggattttggcaaagagaccgtttgtgatctctcgctccacg
ttccccagtcatggctcatattcaggtcactggctaggagacaacaggagccactggaag
gacctttacacctccatcgctggtatgttgacgtttaaccttctgggcatcccgttggta
ggagcagacatctgcggcttcagcgaggagccacaggaggagctgtgtgtccgctggact
cagctgggagctttttatcccttcgcacgaaaccacaactctcttgacatgactcctcag
gatccgaccgctttcagcccgtcggcccgtacggccatgaaacaggctctgctgctgcgt
tactccttctttccgttcctctacaccctctttcatcacgctcacgttaaagggcacact
gtagctcggccgctcatgtttgagtttcccaaagacgtaaaaacttacggcatcgacagt
cagtttctctgggggaggagcttgttggtgactccagtgttggagcctggagtggactac
gtggtcgggtacttcccagaaggcctgtggtatgacttctacactggcgactctgtgagc
agcaaaggggaagaacttcgcctcagtgcaccaatggataaaatcaacctgcatctgcgt
cagggctccattattccaacacaggagcccaatgtgactctgtggatcagtagcggtcag
ccgctgcacctggtctctgctctgtctgacgacggttcggccagcggcgatctgttctgg
gacgacggtgaaaccatcgacacctacgagacggagcggtacacatacgttgtgttcagc
gtctctcagaacacgatgacgtccagcgtgctgcacagcgaccaggaaggctcgttcctc
agcatcgactcggcctcgttctatggggtgaagcagaagccgagcgcggtgctggtgaat
tcccacaagtttcccttcatctacagagacaaccaggtcttgtcagtagcgagcctgggt
ctcagactcacccagaacttcaccatcagctggatgtaa

DBGET integrated database retrieval system