KEGG   Poecilia reticulata (guppy): 103481980Help
Entry
103481980         CDS       T05149                                 

Gene name
ace
Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pret  Poecilia reticulata (guppy)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pret01002]
    103481980 (ace)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pret04147]
    103481980 (ace)
   04090 CD molecules [BR:pret04090]
    103481980 (ace)
Enzymes [BR:pret01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     103481980 (ace)
Peptidases [BR:pret01002]
 Metallo Peptidases
  Family M2
   103481980 (ace)
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103481980 (ace)
CD molecules [BR:pret04090]
 Proteins
  103481980 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 103481980
NCBI-ProteinID: XP_008436068
LinkDB All DBs
Position
LG19
AA seq 1291 aa AA seqDB search
MGAMTPEARRLVRAALLLLPALLLCEALPAAWLPGDYANSVDDAQRFLSDYNSTAEEVFF
YSVSASWNYNTNLTEHNSKLQVLASLEEQAFVEAWGGEASKVFSQGTLNNLTPADKKLIE
KIKSLGAANLPQAEREEYNTILSTMDSIYSTAKVYPQPNISWSLEPELTDILANSRSYKK
LLFAWEGWHNASGVPLKEHYPRFVELSNKASKLDGFDDTGADWRSWYETETFQEDLENLY
KTIEPLYLNLHAFVRRKLYNFYGSKYINLKGPIPAHLLGNMWAQTWNNIYDMMIPFPDKP
NLDVTEEMVKQGYNATHMFRVAEEFFTSLGLKEMPPEFWEGSMLVKPEGREVVCHASAWD
FYNRKDFRIKQCTTVTMEQLFTVHHEMGHIQYYLQYKDQPVGYRRGANPGFHEAIGDVMS
LSVSTPKHLHEINLLESVATDTETDLNFLLKTALEKIAFLPFGYLIDLWRWGVFSGSIPP
EKYNSEWWYLRTKYQGICSPTSRTEEHFDPGAKYHIPGNTPYIRYFVSFILQFQFHEKLC
EAAKHTGPLHTCDIYRSAEAGEILRKVLEAGSSKPWPEVLQEAIGTNKMNATSLMRYFEP
IIKWLEQQNVDETLGWPEFNWVPPIPEGYPEDIDKNTDELDAKQFLDEYNSTVEIVWNAY
TEASWKYNTDITEANNQEVLKKDLEMAAHTLEYGRKARQYDTSDFQDPSVKRIIKKLSDL
EKAALLTEELEELNNITSSMETKYSVAEVCRADGKCHPLDPDLQKIMAESRDYDELLFAW
KGWRDAAGKVIRDDYKRYVELVNKAATLNGHSDNGAFWRSLYETPTFEEDLEALWKELEP
LYLNVHAYVRRALYKKYGSDNINLKGPIPAHLLGNMWAQSWSGIMDLVLPYPDATQVDAT
PAMVAQGWNATRMFQESDRFFTSLGLLPMPQEFWDKSMLEKPTDGRQVVCHASAWDFFNR
KDFRIKQCTVVTMDDLITVHHEMGHVQYFLQYKDQPVSFRTGANPGFHEAIGDVLALSVS
TPKHLQSIGLLDKVESNHESDINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRIPSSDYN
KEWWNLRLKYQGLCPPVTRTEDDFDPGAKFHIPASVPYVRYFVSFVIQFQFHKALCDAAK
HNGPLHTCDIYQSKEAGKLLGDVMRLGYSKPWPEAMAMITGQSKMSAQPLMQYFQPLITW
LEEQNNKNNEVRGWPDYNWRPSDIGEVTTNDDGKVEFLGLKVDKTAAKAGQWLLLSISLA
FLLVIIHLAYRYRKSKKRNKSLSMMELKQKD
NT seq 3876 nt NT seq  +upstreamnt  +downstreamnt
atgggagccatgactcccgaggcgcgcaggctggtgagagcggcgctgctgctgctgcca
gccctgctgctgtgtgaagctctgccagccgcctggctgccaggggactatgcaaactct
gttgacgatgcccagaggttcctcagtgactacaacagcaccgcagaggaggtgttcttc
tacagcgtgtccgccagctggaactacaacaccaacctgacggagcacaactccaagctg
caggtactagcaagtcttgaagaacaagcctttgttgaggcctgggggggagaggcctcc
aaggtcttctctcagggtaccctgaacaatcttactccagccgacaagaagctgattgaa
aagatcaagtcactgggagctgccaaccttccacaggctgaacgagaagagtataacacc
atcctgagcaccatggacagtatttattcaacagctaaggtgtacccacagccaaacata
agctggagcctggaacctgaactcacagatattctggccaactccaggagttataagaag
ttactgtttgcttgggaaggctggcacaatgcatcaggtgtgcctcttaaggagcattat
cccaggtttgtggagctcagcaacaaagcctcaaagctcgatggctttgatgacactggg
gctgattggcgctcttggtatgagacggaaacctttcaggaggatttagaaaatctctac
aagacaattgaaccgctctacctgaacctgcatgccttcgtgcgacgcaagctctacaac
ttctatggatccaaatatatcaacctaaagggacccatccctgcacacctgttgggaaat
atgtgggcccagacatggaataacatttatgatatgatgatcccatttcctgacaaaccc
aacctggatgtgaccgaggagatggtcaaacagggctacaatgctacacacatgttccgt
gtggctgaggagttcttcacgtctctgggtctaaaggagatgcctccagagttctgggaa
gggtcgatgcttgttaagcctgaaggtcgggaagttgtctgccatgcgtctgcctgggac
ttttacaaccgcaaagacttcaggattaagcagtgcaccacagtaaccatggaacagctc
ttcactgtacaccatgagatgggccacatccagtattacctgcagtacaaggatcagcct
gtgggctaccgccgtggagccaaccctggtttccatgaagctatcggtgacgttatgtcc
ctgtcagtttcaacacccaagcacctacatgagattaaccttctggagtctgtggccact
gacacagaaactgatctgaacttcctgttgaagactgctctggagaagatagccttcctt
ccctttggctacctcattgacctctggagatggggcgtgtttagtggaagcattcctcca
gagaagtacaactcggaatggtggtacctcagaacaaagtaccaaggaatttgctcacct
accagccgcacagaggagcactttgatcccggagcaaagtatcatattcctggaaacacg
ccatacatcaggtactttgtcagcttcatcctccagttccagtttcatgagaaactctgt
gaggcagccaagcacaccgggcctctgcacacctgcgacatctaccgttccgcagaggca
ggagagattcttcgaaaagttcttgaagcaggttcctctaagccctggcctgaagtcctc
caagaagctataggcacaaataagatgaatgccacctccctgatgagatactttgagccc
ataatcaagtggctggaacaacaaaatgtggatgagaccctgggatggcctgaattcaac
tgggtcccacccatccctgaaggctaccctgaagatattgacaagaatacagacgagctt
gatgcaaagcagtttctggatgaatacaacagcacagttgaaatagtgtggaatgcctac
actgaggccagctggaagtacaacacggacatcactgaagctaataaccaggaagtgctt
aagaaggacctggagatggcggctcacaccctggagtacggccggaaggctcgccagtac
gacacctctgacttccaggacccctcggtcaaacgcatcatcaaaaaactcagtgacctt
gagaaggcagcgctgcttactgaagaactggaagagttaaataatattacgtctagcatg
gagaccaaatatagtgtggcagaagtttgtagggcagatggcaaatgtcatccactggat
ccagatctccagaaaatcatggcagagtccagggattatgatgaactgttgtttgcctgg
aaaggatggagagatgctgctggcaaagtaattcgtgacgattataagagatatgttgaa
ctggtcaataaggctgcaacactcaatgggcattctgacaacggggctttctggcggtcc
ctgtatgaaaccccaacctttgaagaggacctggaggctttgtggaaggaactggagccg
ctctatctcaacgtacacgcctacgttcgaagggctctttacaaaaagtatggctcagat
aacatcaacttaaaggggcccatccctgctcacttgttgggcaacatgtgggcacagtca
tggtctggaatcatggatttagtcttgccttatccagatgccacacaagtcgatgccaca
ccagctatggtggcgcagggctggaatgcaaccaggatgtttcaggaatcggacaggttt
ttcacctccctgggtctactgccaatgccacaagagttctgggacaaatccatgctggag
aagccgactgacggacgccaggtggtgtgccatgcctctgcgtgggatttctttaaccga
aaggacttcaggataaaacagtgcaccgttgtgactatggatgacctgatcactgtgcac
catgagatgggccatgtgcaatacttcctgcagtacaaagaccagcctgtttcattccgc
actggtgctaacccaggcttccacgaagccatcggagacgttctcgcgctgtccgtctcc
acgcccaaacatctgcagagcatcgggctcctggacaaagtggagagtaaccacgagagt
gacatcaactttttgatgagcatggcgttggacaaaattgccttcctgccttttggctac
ctgatggaccagtggaggtggaaggtcttcgacggacgcatcccatcgtcagattataat
aaagagtggtggaacctcagactgaagtaccagggcctgtgcccccctgtaacccgcaca
gaggatgactttgacccgggcgcaaagttccacatccctgcgagcgtgccatacgtccgg
tacttcgtcagcttcgtcatccagtttcagttccacaaagctctgtgtgacgcagctaag
cataatgggcctctgcacacatgtgatatctaccaatctaaagaagctgggaagctgctg
ggggatgtgatgcggctcggttatagtaagccgtggccggaagccatggccatgatcacg
ggtcagtccaagatgagtgcccagcctctcatgcagtacttccaacctctcatcacatgg
ctggaggagcagaacaataagaacaacgaggtccgtgggtggcccgactataactggaga
ccttcagatataggtgaagttacaacgaatgatgatgggaaagttgagttcctgggacta
aaagtggacaagaccgctgccaaagctggtcagtggttactgctatcaatcagcctggct
ttcctgttggtcatcatccatctcgcctacagatacaggaagtccaagaagcgtaataag
tccttatccatgatggagctcaagcaaaaggactag

DBGET integrated database retrieval system