KEGG   Candidatus Peribacter riflensis: PeribacterA2_0676Help
Entry
PeribacterA2_0676 CDS       T04147                                 

Definition
(GenBank) alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
prf  Candidatus Peribacter riflensis
Pathway
prf00500  Starch and sucrose metabolism
prf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PeribacterA2_0676
Enzymes [BR:prf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PeribacterA2_0676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Glyco_hydro_38 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: ALM10044
UniProt: A0A0S1SNP2
LinkDB All DBs
Position
709137..710429
Genome map
AA seq 430 aa AA seqDB search
MSPLVCLYFQVHQPYRLRDLRITEIGKGTEPDYFDHEKNRSVFRKVAEKCYLPANRMMLS
LLERYPDFAIAYSLSGVFLDQCEEYGEDVLESFRRLGATGRVEFLAETYYHSLSSIRDTE
EFCEQTTLHIRKIEDLFGMTPSIFRNTELIYSNDLAQTVRLMGFKGILAEGTDHLLQGRS
ANLPYMPPRFRLPRSKEMLIARHRPLPQRSENISVLLKNYRLSDDVAFRFSDKSWVGFPL
KAETFTDWLLGGGGHSVNLFMDYETFGEHQWEDTGIFEFLRTLPRIWQERGVHTATPSQV
LAAWEQTTAPIYDVHSLISWADTERDLSAWQGNQIQTSALKAIHELGPLVKATGNANLIN
TWRKLQTSDHFYYMCTKYWNDGDVHKYFSPYDSPYEAYRRYSHALCDLKSRVEPKQKHKQ
HTAHSKRPKS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagtcctcttgtgtgtctctacttccaggttcaccagccctaccgcctgcgggatctg
aggatcaccgaaatcggcaaaggtacagagccggattacttcgaccatgagaagaaccgc
tcggtcttccgcaaggttgcggagaagtgctacctgccggcgaaccgtatgatgctttcg
ctcctggagcggtatccggatttcgccatcgcctactcgctctcgggggtcttcctcgat
cagtgcgaagagtacggagaggacgtgctggagagtttccggcgcctgggcgcaacgggg
cgggtcgaattcctcgccgaaacgtactaccattcgctctcctccatccgcgatacggag
gaattttgcgagcagaccacgctccacatccgcaagatcgaagacctgttcggaatgacg
ccctccatcttccgtaataccgagctgatctacagcaatgacttggcgcagaccgtgcgg
ctcatgggattcaaaggcattctcgcagagggaaccgatcacctgctgcagggcaggagc
gcgaacctcccctacatgcctccgcggttccggctgccccgcagcaaggaaatgctcatc
gcccggcaccgtccgctgccgcagagatcggaaaatatctccgttctgctcaagaactac
cgcctctctgacgacgtggcgttccgcttttcagataagagctgggtgggattcccgctc
aaggcggaaacattcaccgactggctgctcgggggcggcgggcacagcgtgaacctgttc
atggactacgaaacattcggagagcaccagtgggaagacaccggcatctttgaattcttg
aggacactgccgcgtatctggcaggagcgtggcgtgcacacagcgactccctcgcaggtg
ctggccgcctgggagcagaccaccgcgcccatctacgatgtccattcgttgatctcgtgg
gccgataccgaacgcgacctttcggcgtggcagggcaatcagatccagacatccgcgctg
aaggccattcacgaactcggcccgctggtcaaagcaacggggaacgcgaatctgatcaat
acctggcgaaaattgcagacatccgaccacttctactacatgtgcacgaagtactggaac
gacggagacgtacataagtacttcagcccttacgattccccctacgaagcgtaccgccgc
tacagccacgcgctgtgcgatttgaaatcacgcgtggaaccaaaacaaaaacacaaacag
cacacagcacacagcaaacgtcctaagtcctaa

DBGET integrated database retrieval system