KEGG   Providencia rettgeri: RB151_024240Help
Entry
RB151_024240      CDS       T04571                                 

Gene name
alr_2
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
prg  Providencia rettgeri
Pathway
prg00473  D-Alanine metabolism
prg01100  Metabolic pathways
prg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:prg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RB151_024240 (alr_2)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    RB151_024240 (alr_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:prg01011]
    RB151_024240 (alr_2)
Enzymes [BR:prg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RB151_024240 (alr_2)
Peptidoglycan biosynthesis and degradation proteins [BR:prg01011]
 Precursor biosynthesis
  Racemase
   RB151_024240 (alr_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Arteri_nsp7a
Motif
Other DBs
NCBI-ProteinID: APC12095
UniProt: A0A1J0E851
LinkDB All DBs
Position
complement(2616148..2617380)
Genome map
AA seq 410 aa AA seqDB search
MAFRLKYLALLPLFVATTACQQPFNTNANDVATPVVQTQSVVVNNSWIEISRGALEFNVQ
KVQALLGDKSSLCAVLKGDAYGHDLSLVTPIMIENNVQCIGVTNNQELKTVRDLGFKGRL
MRVRNATEQEMAQATQYDTEELIGNLAMAQRLNAIAKQQNKIIPIHLALNSAGMSRNGLE
VSHAAGLNEAKQISELPQLKIVGIMSHYPEEDEAQIRKDLAKFKKGSQQVLAVTGIKRED
VMLHVANTYATITVPESWLDMVRVGGIFYGDTVATNDYKRVMTLKSNIAAVNHYPKGNTV
GYDRTYTLKRDSVLANIPVGYADGYRRVFSNTGHALINGQTVPVLGKTSMNTVMVDVTDL
KQVSPGDEVVFFGKQGNAEITAEEVEDISGALFTEMSILWGATNKRVLVD
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtggcttttcgtttaaaatatcttgcattactaccgctatttgttgctacgacagcatgc
caacaaccgtttaatactaatgctaatgatgtagcaacacctgtagtacaaacccaatcc
gtagtggttaataactcatggattgaaatctcacgaggcgcattagaatttaatgtgcaa
aaagttcaagctctattaggcgataaatcctctctttgcgcggtattgaaaggggatgct
tacggtcatgacctttcattagttacccccattatgattgaaaacaatgttcaatgtatt
ggcgtaacaaacaaccaagaattaaaaacagtgagagacttaggttttaaaggccgttta
atgcgagtgagaaatgcgactgagcaggaaatggcacaagcgacacaatatgacacggaa
gaactcattggtaatttagcaatggcgcaacgtttgaatgcgattgcaaaacaacaaaat
aaaatcattcctattcatttagcgctaaattcggcagggatgtcccgtaatggactcgaa
gtaagccatgccgctggtttgaatgaagcgaagcagatttcagaattaccgcaattaaaa
atcgtgggaattatgtctcactatccagaggaagatgaagctcaaatccgtaaagatctt
gcaaaattcaagaaaggatcacaacaagtcttggcggtaactggaataaagcgtgaagat
gtgatgctgcatgtggcgaatacttatgcaactattactgtccccgagtcgtggctagat
atggtgcgtgtaggagggatcttttatggtgacaccgttgcaacgaacgactataaacgt
gtaatgacgcttaaatcaaatattgctgcggtgaatcattaccctaaaggaaatactgtg
ggttatgacagaacttatactttgaaacgagattctgttttggccaatattcctgttggt
tatgctgatggctaccgtcgagtatttagtaatactggtcatgcattgatcaatggccaa
actgttcctgtgttaggaaaaacatcaatgaataccgttatggtggatgttactgattta
aaacaagtcagcccaggtgatgaagtcgtattttttggtaaacaagggaatgccgagata
acggctgaagaagttgaagatatcagtggcgcactttttacagagatgtcgatcctgtgg
ggcgcaacaaataaacgtgttttagtcgactag

DBGET integrated database retrieval system