KEGG   Providencia rettgeri: RB151_030430Help
Entry
RB151_030430      CDS       T04571                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
prg  Providencia rettgeri
Pathway
prg00473  D-Alanine metabolism
prg00550  Peptidoglycan biosynthesis
prg01100  Metabolic pathways
prg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:prg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RB151_030430 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RB151_030430 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    RB151_030430 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:prg01011]
    RB151_030430 (ddl)
Enzymes [BR:prg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RB151_030430 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:prg01011]
 Precursor biosynthesis
  Amino acid ligase
   RB151_030430 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_Ter RimK ATPgrasp_ST ATP-grasp_3 TTL ATP-grasp ATPgrasp_YheCD GARS_A
Motif
Other DBs
NCBI-ProteinID: APC12701
UniProt: A0A1J0EAI2
LinkDB All DBs
Position
complement(3279522..3280442)
Genome map
AA seq 306 aa AA seqDB search
MAEKVAVLLGGTSAEREVSLQSGSAVLTGLRQAGIDAHPIDTKDFPVETLRNAGFDKVFI
ALHGRGGEDGTLQGLLEFLNLPYTGSGVMASALSMDKLRTKQLWEGAGLSVSPYVYLTQQ
QYTQASHEQVIEKVQQLGLPLIVKPSLEGSSVGMSKVDSLETLSSALELAFQFDDTVLIE
KWLSGPEFTVAILGDKTLPSIRIQPPGIFYDYEAKYLSDETQYFCPSGLDEQAESELSEL
AMNAYQTVGCEGWGRVDVMQDSDGQFYLLEVNTSPGMTSHSLVPMAARQAGMEFSELVVQ
ILKLAR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaagttgcggttttattaggagggacatccgctgaacgtgaggtttcactt
cagtcagggagtgctgtgctgacagggttacgtcaagcaggtattgatgctcatcctatt
gataccaaagattttcctgttgaaacactgagaaatgcaggtttcgataaagtatttatt
gcgttacatggtcgtggcggtgaagacggaacattacaggggttattggaatttttaaac
ctaccttatactggtagcggtgtaatggcctcggcactcagcatggacaagctaagaaca
aaacaattgtgggaaggggcagggttaagtgtgtctccgtatgtatacttgactcagcag
cagtatacccaagcttcccatgaacaagttatcgaaaaggttcaacaactcggtttacca
cttattgttaagccaagtttagaaggttccagtgttgggatgagtaaagtcgacagttta
gagacattgtcttcagcactagaattggcatttcagtttgacgatacagtgttgatagaa
aaatggcttagtggcccagaatttacggttgcaatattaggtgataagacattaccgtcc
atccgtattcaaccaccgggtattttttatgactatgaagcaaaatatctgtcagatgaa
acgcaatatttttgcccaagtggtttagatgaacaagcggaatctgagttgtctgagtta
gcaatgaatgcatatcagacagtaggatgtgaaggctgggggcgagtggatgtaatgcaa
gatagtgacggtcagttctatttattagaagtgaatacctcaccaggcatgactagccat
agcctagtaccaatggccgcacgtcaagcaggtatggagttttctgagttagttgtgcaa
attttgaaattggctcgttga

DBGET integrated database retrieval system