KEGG   Providencia rettgeri: RB151_037310Help
Entry
RB151_037310      CDS       T04571                                 

Gene name
arcB_2
Definition
(GenBank) Aerobic respiration control sensor protein ArcB
  KO
K07648  two-component system, OmpR family, aerobic respiration control sensor histidine kinase ArcB [EC:2.7.13.3]
Organism
prg  Providencia rettgeri
Pathway
prg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:prg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RB151_037310 (arcB_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:prg01001]
    RB151_037310 (arcB_2)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:prg02022]
    RB151_037310 (arcB_2)
Enzymes [BR:prg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     RB151_037310 (arcB_2)
Protein kinases [BR:prg01001]
 Histidine kinases
  OmpR family
   RB151_037310 (arcB_2)
Two-component system [BR:prg02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   RB151_037310 (arcB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HKR_ArcB_TM Response_reg PAS HisKA PAS_4 Hpt PAS_9 HATPase_c_3 PAS_8 7TMR-HDED
Motif
Other DBs
NCBI-ProteinID: APC13379
UniProt: A0A1J0EBM3
LinkDB All DBs
Position
complement(4006854..4009199)
Genome map
AA seq 781 aa AA seqDB search
MKVLRGLAQYYVDLMMKLGLVRFSLLLASALVVLAMIMQMAVTIFLRGHVDSLDMVGSIF
FGLIITPLAVYFLSVVVEQLEESRQRLSRMVDKLEVMRKRDAELNIQLHGNIEQLNLEIQ
EREKAERAHLELLEQLKQEMKYREQTQVELEQQSVLLRSFLDASPDLVYYRNENNEFSGC
NRAMELLTGKSEKHLVGLTPLDIYDVEIASKVMETDEKVFRHNVSLTYEQWLVYPDGRKA
CFELRKVPFYDRVGKRHGLMGFGRDITERKRYQEALENASREKTTFISTISHELRTPLNG
IVGLSRILLDTNLTSEQSSYLKTIHVSAVTLGNIFNDVIEMDKIERRKVQLDNQPVALPE
FVNDLENLSGLLVQPKGLKFVMDVAPTLPKTVLTDGTRLRQVLWNLIGNAVKFTQQGEVK
VSIWQEPENKIFFRVKDSGIGIPQDELDKIFAMYYQVTDSAGGKPATGTGIGLSVSRRLA
QNMGGDIQVESEIGQGSTFTLSITAPVVEEEVAEHQDSDDDYPLPALHILLVEDIELNVV
VACSVLENLGNTVDVAMNGKDALAMFAPGEYDLVLLDIQLPDMTGLDISRQLKQQYDKED
LPPLIALTANVLKDKKEYFDAGMDGVLSKPLSVPALTQVIEQFWGEHTSQNEEVENRDVT
SQVDESILDCDMLEQYIELVGPKLIYDGLDVFEKMLPGYLAILDSNMVAKDQKGIVEEAH
KIKGAAGSVGLKNLQKIAQQIQSPDLPAWWDNVQEWVDELKQDWKADIETLRNWVDERTK
K
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacttcgcggccttgcgcaatactatgtcgatttgatgatgaaactagggctg
gtgcggttttcactattactagcatccgcgctggttgttcttgccatgataatgcagatg
gccgtgacaatctttttgcgagggcatgttgatagcctcgatatggtcgggtcgattttc
tttggcttaatcattacccctttagcggtttattttctttcggttgtcgttgagcagtta
gaagagtcgcggcaacgtttgtcgcgcatggtcgataaacttgaagtcatgcgtaagcgc
gatgcggaattaaacattcaattacatggcaatattgagcaactaaatcttgaaatacaa
gagcgcgaaaaagctgaaagagcgcacttggaactgcttgaacaactcaaacaagaaatg
aaatatcgagagcaaacacaggttgaacttgaacaacaatcggtgttgctgcgctcattc
cttgatgcatcaccggatttagtttattaccgcaacgaaaataacgagttttcaggttgt
aacagagcaatggaactgttgactggtaaaagtgaaaaacacttagttgggttaacacct
ctagatatttatgatgtcgaaattgcgtctaaagtaatggagaccgatgaaaaagttttc
cgccataatgtttccctcacttatgaacagtggctggtttaccctgatggcagaaaagcc
tgttttgagttacgaaaagtcccattttatgaccgagtaggtaaacgacatggccttatg
ggctttggtcgcgatataacagagcgtaaacgctaccaggaggcgttagagaacgcgagc
agggaaaagactacctttatctcaacgataagccacgagcttcgtacgccgcttaatggc
atcgttggtcttagtcgtattttactcgatacgaatttaacttcagaacaatctagctat
ttaaaaacgattcatgtcagtgcagtgacattagggaatatttttaatgatgtcattgag
atggataaaattgagcgtcgtaaagtccaactagataaccaacccgtcgcattacctgag
tttgtgaatgatttagagaatctaagtgggttattagttcagcctaaagggcttaaattt
gttatggatgtggcacctactttgccaaaaacggtgttaactgatgggacgcgtttacgg
caggtattatggaatttaattgggaatgcggttaagttcacgcaacaaggtgaggtcaaa
gtaagtatttggcaagagcctgaaaacaaaatcttttttagggtaaaagacagtggtatt
ggcatacctcaggatgagttagataaaatctttgcgatgtactatcaagtaacagattct
gctggtggtaaacctgcaacagggacggggattggtctttctgtatcacgtcggttagca
caaaatatggggggcgacatacaggttgagagtgaaataggccaaggttctacttttact
ttatcaattacagcgcctgtggttgaagaagaagtcgctgaacatcaagacagtgatgat
gattacccactaccagccttgcatattttattagtggaagacattgaactcaatgttgtt
gttgcgtgttctgtattagaaaaccttggcaatacagttgatgtagcgatgaatggtaaa
gatgcattagcaatgtttgctcccggtgaatatgatttagtgttattagacattcaatta
ccagatatgacaggtttagatatttctaggcagcttaaacaacagtatgacaaagaagat
ttaccaccattaatagccttaacggcaaatgtccttaaggataaaaaagaatattttgat
gcgggaatggatggcgtattgagtaaaccgttgtcggttcctgctttaactcaagttata
gaacaattttggggggagcatacttcccaaaatgaggaagttgaaaaccgcgatgtcaca
tcacaagttgatgagtctatattagattgtgacatgttagagcagtacattgaattagtc
ggccccaaactgatttatgatgggttagatgtttttgaaaaaatgttgccgggttattta
gctattcttgattcgaatatggtggctaaggaccaaaaaggtattgttgaagaggcccat
aaaattaaaggtgccgctggctctgttggtttaaagaatttacagaaaatcgcacagcaa
attcaatctcctgatttaccagcatggtgggataatgttcaggaatgggttgatgaatta
aaacaagactggaaagcagatatagaaactttaagaaactgggttgatgagcgtacaaaa
aaataa

DBGET integrated database retrieval system