KEGG   Providencia rettgeri: RB151_043160Help
Entry
RB151_043160      CDS       T04571                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
prg  Providencia rettgeri
Pathway
prg00250  Alanine, aspartate and glutamate metabolism
prg00410  beta-Alanine metabolism
prg00430  Taurine and hypotaurine metabolism
prg00650  Butanoate metabolism
prg01100  Metabolic pathways
prg01110  Biosynthesis of secondary metabolites
prg01120  Microbial metabolism in diverse environments
prg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:prg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RB151_043160 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RB151_043160 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RB151_043160 (gadB)
   00430 Taurine and hypotaurine metabolism
    RB151_043160 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RB151_043160 (gadB)
Enzymes [BR:prg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     RB151_043160 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: APC13937
LinkDB All DBs
Position
4604210..4605610
Genome map
AA seq 466 aa AA seqDB search
MSNRSLNPKYNGMDDVYASLELSKSLPKTKFPSKEQEPRNVFSAVRDELMLDGNSRQNLA
TFCQTWVDDEIRDLMDLSIDKNMIDKDEYPQTAEIENRCVHMLADLWHSPDAENTLGCST
IGSSEAAMLGGLALKWQWRKKRAAAGKPTDKPNMICGPVQVCWHKFARYFDVELREIPLE
GDRLIMNPEEVLKRVDENTIGVVPTLGVTFTCQYEPVKAVHDALDKLQKETGLDIPIHVD
GASGGFLAPFCAPDLEWDFRLPRVKSINSSGHKFGLAPLGAGWVVWREAQDLPEELIFNV
NYLGGNMPTFALNFSRPGGQIIAQYYNFLRLGREGYAKIHNSCYATAQFLAREIEKLGPF
EMIFDGDSQKGIPALAWKLKKGETTSNYSLYDIADKLRSRGWQVPAYSMPANREDLVVQR
ILVRHGVSLDLAALLIEDFKRTLDYFEKHPVNKPLTEDEGGGFNHS
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcgttcattgaatccaaaatataatgggatggatgacgtttatgcgtcatta
gagttatcaaaatcattaccaaaaactaaatttccatcaaaagaacaagaacctcgcaat
gtatttagtgcagtgcgagatgaattaatgttagatggtaattcacgtcaaaatttagca
acattctgccaaacttgggtagatgatgaaattcgtgacttaatggacttatctatcgat
aaaaatatgatcgataaagatgaatatccacaaactgccgaaattgaaaaccgttgtgta
catatgctagcggatctttggcattcgccagatgcagaaaatacccttggctgctcgacc
atcggttcttctgaagcagcaatgcttggagggctagccttaaagtggcaatggcgtaaa
aaacgtgcagcagcaggaaagccaacagacaaaccaaacatgatctgtggccctgttcaa
gtatgttggcataaatttgcccgctactttgatgttgaactcagggagatcccacttgaa
ggcgatcgcctgattatgaaccctgaggaagtgcttaaacgtgtagatgaaaatacgatt
ggtgtagtaccaacgttaggcgtgacatttacttgccaatatgaacctgttaaagcagtt
catgatgcattagataagttacaaaaagaaacgggcttagatattcctatccatgtcgat
ggtgcaagcggtgggttcctagcaccattttgtgcgccagatttagaatgggacttccgt
ttacctcgcgtaaaatcgattaactcttccggacataaatttggtttagctccattaggc
gcaggctgggtagtctggcgtgaagcgcaagacttacctgaagaattaattttcaatgta
aactatttaggtggcaatatgccaaccttcgcgcttaacttctctcgcccaggtggtcaa
attatcgctcagtactataacttcctgaggctcggtcgtgaaggctatgcaaaaattcat
aattcttgctacgcaactgcgcaattcctagcccgcgaaatcgaaaagttaggtccattt
gaaatgattttcgatggtgatagccaaaaaggtatcccagcgctggcttggaagttgaaa
aaaggcgagaccaccagcaattattccctctatgacatagcagataaactacgtagtcgt
ggatggcaagtccctgcatattcaatgccagcaaaccgtgaagacctcgttgttcaacgt
atcttagttcgtcacggagtaagtttagacttagccgcattgttaattgaagattttaaa
cgcacgctagattatttcgaaaaacatccagtcaataaaccgctaacagaagatgaaggc
ggcggttttaaccacagttaa

DBGET integrated database retrieval system