KEGG   Pseudomonas rhizosphaerae: LT40_02155Help
Entry
LT40_02155        CDS       T03339                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
prh  Pseudomonas rhizosphaerae
Pathway
prh00061  Fatty acid biosynthesis
prh00780  Biotin metabolism
prh01100  Metabolic pathways
prh01130  Biosynthesis of antibiotics
prh01212  Fatty acid metabolism
Module
prh_M00083  Fatty acid biosynthesis, elongation
prh_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:prh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LT40_02155
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LT40_02155
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LT40_02155
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:prh01004]
    LT40_02155
Enzymes [BR:prh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     LT40_02155
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     LT40_02155
Lipid biosynthesis proteins [BR:prh01004]
 Fatty acid synthase
  Component type
   LT40_02155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AIS16263
UniProt: A0A089YIP9
LinkDB All DBs
Position
complement(460918..461712)
Genome map
AA seq 264 aa AA seqDB search
MGFLAGKRVLIVGVASKLSIASGIAAAMHREGAELAFTYQNEKLKGRVEEFAAGWGSSAD
LCFPCDVASDAEIASVFEALSKKWDGLDVIVHSVGFAPGDQLDGDFTQATTREGFRIAHD
ISAYSFVALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSL
GPEGTRVNAVSAGPIRTLAASGIKNFRKMLAANEAQTPLRRNVTIDEVGNAGAFLCSDLA
SGISGEIMYVDGGFNTTAMGDIEE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctcgccggtaagcgcgtcctgatcgtcggtgtcgccagcaaactgtccatc
gcatccggcatcgccgccgccatgcatcgcgagggtgctgaacttgccttcacctaccag
aacgaaaagctcaagggccgcgtcgaggaattcgccgcaggctggggctccagcgccgat
ctgtgcttcccttgcgacgtggccagcgatgctgaaatcgcctcggtcttcgaagccctg
agcaagaagtgggacggcctggacgtcatcgttcactccgtcggtttcgccccgggcgac
cagctcgatggcgacttcacccaggccaccacccgcgaaggcttccgcatcgcccacgac
atcagcgcctacagcttcgtggccctggccaaggctgggcgcgaaatgatgaaaggccgc
aacggcagcctgctgaccctgtcctacttgggcgccgagcgcaccatgcccaactacaac
gtcatgggcatggccaaggcttcgctggaagccggcgtgcgctacctggccggctccctg
ggcccggaaggcacgcgcgtcaacgccgtttcggctggcccgatccgcaccctggcagcc
tcgggcatcaagaacttccgcaagatgctggccgccaacgaagcgcagaccccgctgcgc
cgcaacgtcaccatcgacgaagtcggcaacgccggcgcgttcctgtgctccgacctggcg
tcgggtatcagcggtgaaatcatgtacgtggacggcggcttcaacaccaccgccatgggt
gatatcgaagaataa

DBGET integrated database retrieval system