KEGG   Pseudomonas rhizosphaerae: LT40_02990Help
Entry
LT40_02990        CDS       T03339                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
prh  Pseudomonas rhizosphaerae
Brite
Enzymes [BR:prh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LT40_02990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AIS16418
UniProt: A0A089YJ88
LinkDB All DBs
Position
645225..645749
Genome map
AA seq 174 aa AA seqDB search
MKSYGWLALMAAMSIGSANAASKEVQINLVSAEGAPQPIGTVMIEETPYGLEFTPQLKSL
PAGVHGFHVHANGSCAAAMKDGKMSAAEAAGGHFDPQKTGKHLGPYDAKGHLGDLPAIYV
NADGTANYPVLAPRLKKLSEVEGHALMVHAGGDNHADSPAPLGGGAARMACGVI
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcttatggctggcttgcactgatggcagcgatgtcgatcggtagcgccaatgcg
gcatccaaggaagtccagatcaacctggtcagcgccgagggcgcgccacagccgatcggc
acggtgatgatcgaggaaacgccctatggccttgagttcacaccccaactcaagtctctg
cccgcgggtgtgcatggattccacgtacatgccaatggcagctgcgcggcggcgatgaag
gacggcaagatgtcggctgcggaagcggcgggcgggcacttcgatccacagaagaccggc
aagcaccttggcccatacgatgccaaaggtcatttgggtgatctgccggcgatctatgtg
aacgccgatggcactgcgaactatccagtgctggcgccgcgcttgaagaaactgagcgag
gtggaagggcatgcgttgatggtgcatgccggtggtgataaccatgctgattcgccagca
ccgctggggggtggtgcggcgcggatggcttgtggggtgatttga

DBGET integrated database retrieval system