KEGG   Pseudomonas rhizosphaerae: LT40_04110Help
Entry
LT40_04110        CDS       T03339                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
prh  Pseudomonas rhizosphaerae
Pathway
prh00473  D-Alanine metabolism
prh00550  Peptidoglycan biosynthesis
prh01100  Metabolic pathways
prh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:prh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LT40_04110
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LT40_04110
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    LT40_04110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:prh01011]
    LT40_04110
Enzymes [BR:prh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LT40_04110
Peptidoglycan biosynthesis and degradation proteins [BR:prh01011]
 Precursor biosynthesis
  Amino acid ligase
   LT40_04110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_Ter ATPgrasp_YheCD TTL ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AIS16634
UniProt: A0A089YM24
LinkDB All DBs
Position
887991..888950
Genome map
AA seq 319 aa AA seqDB search
MNILDSNTLRSQIMPSDFGRVAVLYGGKSAEREVSLKSGAACLQALQSAGVDAFGIDVGD
DLLARLQAQKIDRAFIILHGRGGEDGSMQGLLECLDIPYTGSGILASALAMDKLRTKQVW
QSLGLATPAHAVLASEQDCIFAAGELGFPLIVKPAHEGSSIGMAKVNSVDELVAAWKAAS
TYDSQVLVEQWVHGPEFTVATLRGQMLPPIALGTPHTFYDYDAKYVANDTQYRVPCGLEP
AKEQELIDLCARACDAIGIQGWGRVDVMQDQQGRFWLLEVNTAPGMTDHSLVPMAAKAAG
LDFQQLVLAILAASCKARG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacattctggattccaacaccctgcgttcgcagatcatgcccagtgacttcggtcgc
gtggccgtgctctacggtggcaagagcgccgagcgcgaggtctcgctgaaatcgggcgcc
gcgtgcctgcaggccttgcagagcgcgggcgtggacgcgttcgggatcgacgtcggcgac
gacctgctggcccgcctgcaggcgcagaagatcgaccgtgccttcatcatcctgcacggc
cgtggcggcgaagacggcagcatgcagggcctgctcgagtgcctggacatcccctacact
ggcagcggcatcctcgccagcgccctggcgatggacaagctgcgcaccaagcaggtgtgg
cagagcctgggtctggcgacccccgcgcacgcggtgctggccagcgagcaggattgtatt
ttcgccgctggggaactgggcttccctttgatcgtcaaacccgcccatgaaggttcaagc
atcgggatggccaaggtgaacagcgtcgacgaactggtcgccgcctggaaagccgccagc
acctacgattcgcaagtgctggtcgagcaatgggtccacggcccggagttcaccgttgcg
accctgcgtggccagatgctgccccccatcgcgttgggtacgccccacacgttctacgac
tacgacgccaaatacgtcgccaacgatacccagtatcgcgttccctgcggccttgagccg
gccaaggaacaggaactcatcgacctctgcgcccgcgcctgcgatgccatcggcatccag
ggctgggggcgtgtggatgtgatgcaggaccagcagggccgtttctggctgctggaagtc
aacacggccccgggcatgaccgatcacagcctggtgcccatggcggcgaaagcggctggc
ctggatttccagcagttggtgctggcgatcttagccgccagctgcaaggcacgagggtaa

DBGET integrated database retrieval system