KEGG   Pseudomonas rhizosphaerae: LT40_05075Help
Entry
LT40_05075        CDS       T03339                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
prh  Pseudomonas rhizosphaerae
Pathway
prh00220  Arginine biosynthesis
prh00250  Alanine, aspartate and glutamate metabolism
prh00290  Valine, leucine and isoleucine biosynthesis
prh01100  Metabolic pathways
prh01110  Biosynthesis of secondary metabolites
prh01130  Biosynthesis of antibiotics
prh01210  2-Oxocarboxylic acid metabolism
prh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:prh00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LT40_05075
   00290 Valine, leucine and isoleucine biosynthesis
    LT40_05075
   00220 Arginine biosynthesis
    LT40_05075
Enzymes [BR:prh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LT40_05075
    2.6.1.66  valine---pyruvate transaminase
     LT40_05075
Amino acid related enzymes [BR:prh01007]
 Aminotransferase (transaminase)
  Class I
   LT40_05075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Costars Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AIS16820
UniProt: A0A089YT04
LinkDB All DBs
Position
complement(1111250..1112461)
Genome map
AA seq 403 aa AA seqDB search
MQFSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPVEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMSLQALLNNGDE
VLIPAPDYPLWTASVSLAGGHAVHYLCDEQANWWPDLDDIKAKITPNTKAMVIINPNNPT
GAVYSREVLLGMLELARQHNLVVFSDEIYDKILYDDAVHICTASLAPDLLCLTFNGLSKS
YRVAGFRSGWIAISGPKHNAQSYIEGIDILANMRLCANVPSQHAIQTALGGYQSINDLVL
PNGRLLEQRNRTWELLNDIPGVSCVKPMGALYAFPRIDPKVCPIHNDEKFVLDLLLSEKL
LVVQGTAFNWPNPDHFRVVTLPRVDDLEQAIGRIGSFLKNYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcagcaaatcgaacaagctcgccaacgtctgctatgacattcgcgggcccgtg
ctcaagcacgccaagcgcctggaagaggaaggccaccgcatcctcaagctgaacatcggc
aacccggcgccgttcggtttcgaggcgccggtcgagatcctccaggacgtcatccgcaac
ctgcccaccgcccagggctacagcgactccaagggcctgttcagtgcgcgcaaggcggtc
atgcagtactaccagcagaagcaggtggaaggtgtcggcatcgaggacatctacctgggc
aacggcgtgtccgagctgatcgtcatgtcgctgcaggccctgctcaacaatggcgacgaa
gtgctgatcccggcgcccgactacccgctgtggacggcctcggtgagcctggccggcggc
catgccgtgcactacctgtgcgacgagcaggccaactggtggccggacctggacgacatc
aaggccaagatcacgcccaacaccaaggccatggtgatcatcaacccgaacaacccgacc
ggcgccgtgtactccagggaagtgctgctgggcatgctggaactcgcccgccagcacaac
ctggtggtgttctcggacgagatctacgacaagatcctctatgacgatgccgtgcacatc
tgcaccgcctcgctggcgccggacctgctctgcctgaccttcaatggcctgtccaagtcc
taccgcgtggctggtttccgctcgggctggatcgccatctccgggcccaagcacaatgcc
cagagctacatcgaaggcatcgacatcctggccaacatgcgcctgtgcgccaacgtgccg
agccagcacgcgatccagaccgcgctgggcggctaccagagcatcaacgacctggtcctg
cccaacggccgcctgctggagcagcgcaaccgcacctgggaactgctcaacgacattccc
ggtgtcagctgcgtcaaacccatgggcgcgctgtacgccttcccgcgcatcgaccccaag
gtctgcccgattcacaacgacgagaagttcgtgctcgacctgctgttgtcggagaagctg
ctggtggtccagggcactgcgttcaactggcccaacccggaccatttccgcgtagtgacg
ctgccccgggtcgacgatctggagcaggccatcggtcgcatcggcagctttctgaagaat
tatcgccagtaa

DBGET integrated database retrieval system