KEGG   Pseudomonas rhizosphaerae: LT40_05990Help
Entry
LT40_05990        CDS       T03339                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
prh  Pseudomonas rhizosphaerae
Pathway
prh00061  Fatty acid biosynthesis
prh01100  Metabolic pathways
prh01212  Fatty acid metabolism
Module
prh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:prh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LT40_05990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:prh01004]
    LT40_05990
Enzymes [BR:prh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     LT40_05990
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     LT40_05990
Lipid biosynthesis proteins [BR:prh01004]
 Fatty acid synthase
  Component type
   LT40_05990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AIS16984
UniProt: A0A089YN57
LinkDB All DBs
Position
complement(1302783..1303298)
Genome map
AA seq 171 aa AA seqDB search
MTKQNAFTREDLLRCSRGELFGPGNAQLPAPNMLMVDRITHISAEGGKYGKGELVAELDI
TPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFFLGWQDLPGRGRALGSGEVKFFGQVLPT
AKKVTYNIHIKRVLKGKLNMAIADGSVSVDGREIYTADGLRVGVFTSTENF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaaaacgcctttacccgggaagatctgctgcgctgcagtcgtggcgagctg
ttcggcccaggtaacgcgcaattgcccgccccgaacatgctgatggtggaccgcattacc
catatcagcgccgaaggtggcaagtatggcaagggtgaattggtcgccgagctggatatc
accccggacctgtggttcttcgcctgccacttcgagggcgatccggtgatgccgggctgc
ctgggcctggatgccatgtggcagctggtcggtttcttcctgggctggcaggacctgccg
ggccgtggtcgtgcgctgggttcgggcgaagtgaagttcttcggccaagtgctgccgacc
gccaagaaggtcacgtacaacattcatatcaagcgcgtgctcaagggcaagctgaacatg
gccatcgccgatggttcggtcagtgtcgacggccgcgagatctacaccgccgacggcctt
cgggttggcgtctttacatccaccgaaaatttctaa

DBGET integrated database retrieval system