KEGG   Pseudomonas rhizosphaerae: LT40_07460Help
Entry
LT40_07460        CDS       T03339                                 

Definition
(GenBank) bicarbonate ABC transporter permease
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
prh  Pseudomonas rhizosphaerae
Pathway
prh00910  Nitrogen metabolism
prh02010  ABC transporters
Module
prh_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:prh00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    LT40_07460
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LT40_07460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:prh02000]
    LT40_07460
Transporters [BR:prh02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    LT40_07460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AIS17249
UniProt: A0A089YNS7
LinkDB All DBs
Position
complement(1628934..1629809)
Genome map
AA seq 291 aa AA seqDB search
MNAEVKKLHSAAQAVAKAQVKPPRMASLLKNTRRFVLQQCLPPVVIGALLLLVWQLVCSG
KGAALPPPTQVITDTWELIVDPFYDNGGNDKGMAWQLLASLSRVAYGYALAVVVGISLGV
LVGQSTWAMRGLDPLFQILRTVPPLAWLPLSLAGFKDSYPSAIFVIFITAIWPIIINTSV
GVRNIPEDYRNVAKVLRLNGLEYFSKIMLPAAAPYIFSGLRIGVGLSWLAIIAAEMLIGG
VGIGFFIWDAWNASRISDIILALAYVGVVGFCLDRLVAMVGRLVTRGTSQS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgaagtgaagaagctgcacagcgccgcccaggcggtcgccaaggcgcaggtc
aagccgccgcggatggccagcctgctgaagaacacccgccgcttcgtgttgcaacagtgt
ttgccaccggtggtgattggcgccctgttgttgctggtctggcaactggtgtgcagcggc
aagggcgcggcgctgccgccgccgacccaggtcatcaccgacacctgggagctgatcgtc
gacccgttctacgacaacggcggcaacgacaagggcatggcctggcagttgctggccagc
ctgtcacgggtcgcctatggctacgccctggccgtggtggtggggatcagcctcggtgtg
ctggtggggcagtcgacctgggccatgcgcggcctcgatccgctgttccagatcctgcgt
acggtgccgccgctggcctggctgccgctgtcgctggccggcttcaaggacagctaccct
tcggcgatcttcgtgatcttcatcacggccatctggcccatcatcatcaacacctcggtg
ggcgtacgcaacattcccgaggactaccgcaacgtggccaaggtactgcggctcaacggc
ctggaatacttcagcaagatcatgctgccggcggccgcgccctacatcttctccggcctg
cgcatcggtgtcggcctgtcgtggctggcgatcatcgctgcggaaatgctgattggcggt
gtcggcatcgggttcttcatctgggacgcctggaacgcctcgcgcatcagcgacatcatc
ctcgccctggcctacgtaggggtggttggcttctgcctcgaccgtctcgtggcgatggtc
ggacgcttggtcacccgtggcacttcgcaaagctga

DBGET integrated database retrieval system