KEGG   Pseudomonas rhizosphaerae: LT40_09560Help
Entry
LT40_09560        CDS       T03339                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
prh  Pseudomonas rhizosphaerae
Brite
KEGG Orthology (KO) [BR:prh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LT40_09560
Enzymes [BR:prh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LT40_09560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_oxidored Glutaredoxin NAD_binding_7 FAD_binding_3 DAO Thi4 K_oxygenase FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIS17628
UniProt: A0A089YMI9
LinkDB All DBs
Position
2105611..2107173
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKAYLERVTQPIEIVASLDDGAKSEELLGLLRDIDALSDKITLLDNGNDAR
KPSFSINRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSKASAEVIEQIAALKGEFLF
ESYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVEERQVMAVPSVYLNGKNF
GQGRMGLEEILAKIDTSASDRQAEKLNAKKAFDMLVIGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLAVALEEHVKQYEVDIMNLQRAEKLVPGKDGAP
HEVIFASGASLKAKTLILATGARWREMNVPGEQEYRNRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLIEFDTQLRADAVLQRKLHSLPNVKVITSALTTEVTGDGQ
RVNGLRYKDRQSSEHHEIALEGIFVQIGLLPNTDWLKGTIELSNRGEIMVDARGETDLPG
IFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaagcctatctggaacgggtcacccaaccg
atcgagatcgtcgcgtcccttgatgacggcgcgaaatccgaagaattgctcggtctgctg
cgtgacattgatgccctgtcggacaagatcacgctgctggacaacggtaacgatgcgcgc
aagccatcgttctcgatcaaccgccctggggcggacatcggcctgcgtttcgccggtatt
cccatgggtcacgaattcacctcgctggtactggcgctgctgcaagttggcggccacccg
tccaaagccagtgccgaggtcatcgaacagatcgccgcattgaagggtgaattcctgttc
gaaagttatttctcgctgtcgtgccagaactgcccggacgtggtccaggcgctgaacctg
atggcggtgctcaaccccaacattcgtcacgtggccatcgacggcgccctgttccaggcc
gaagtcgaagagcgccaggtgatggccgtgccgagcgtctacctgaacggcaagaacttc
ggtcagggccgcatgggtcttgaagagatcctggcgaagatcgacaccagtgccagcgac
cgccaggccgaaaagctcaacgccaagaaggcgttcgacatgctggtgatcggtggtggc
cctgcgggtgcatcggcggccatctatgcagcgcgtaaaggtattcgtaccggtgttgca
gccgaacgcttcggcggtcaggtgctggacaccatggccatcgagaacttcatttccgtg
caggagaccgaaggtccgaaactggccgtagcgctggaagagcacgtcaagcagtacgaa
gtggacatcatgaacctgcagcgcgccgagaaactggtgcctggcaaggacggcgcgccc
cacgaagtcatcttcgccagcggcgcttcgctcaaggccaagacgctgattctggcgact
ggtgcgcgctggcgtgaaatgaatgtgccgggcgagcaggaataccgcaaccgcggcgtg
gcctactgcccgcactgcgacggtccgctgttcaaaggcaagcgtgtggccgtgatcggt
ggcggtaactcgggtgtggaagcagccatcgatttggccggtatcgttgcccacgtgacg
ctgatcgagttcgacactcagctgcgtgccgacgccgtgcttcagcgcaagttgcacagc
ctgcccaacgtcaaggtcatcaccagtgccttgaccactgaagtgaccggtgatggccag
cgcgtcaacggcctgcgctacaaggaccgccagagcagcgagcatcacgaaatcgcgctg
gaaggtatcttcgtgcagatcggcctgctgcccaataccgattggctcaagggcaccatc
gagctgtcgaaccgtggcgagatcatggtcgatgcccgcggtgaaaccgatctgccaggc
attttcgccgccggtgatgtgacgaccgtgccgtacaagcagatcgtgatcgcggtgggc
gagggcgccaaggcttcgttgtcggccttcgaccacctgatccgcacatccgcaccggcc
tga

DBGET integrated database retrieval system