KEGG   Pseudomonas rhizosphaerae: LT40_13015Help
Entry
LT40_13015        CDS       T03339                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
prh  Pseudomonas rhizosphaerae
Pathway
prh00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:prh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LT40_13015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:prh01003]
    LT40_13015
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:prh01011]
    LT40_13015
Enzymes [BR:prh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     LT40_13015
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LT40_13015
Glycosyltransferases [BR:prh01003]
 Polysaccharide
  Bacterial polysaccharide
   LT40_13015
Peptidoglycan biosynthesis and degradation proteins [BR:prh01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   LT40_13015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase UvrB_inter
Motif
Other DBs
NCBI-ProteinID: AIS18252
UniProt: A0A089YV18
LinkDB All DBs
Position
complement(2869418..2871742)
Genome map
AA seq 774 aa AA seqDB search
MTRTRSSRTPKKSPSGGLRTWLGWGLKLGLVGLVILAGFAVYLDAVVQEKFSGKRWTIPA
KVYARPLELFVGQKLAKNDFLTELDALGYRRQTSVDGPGTDSVNGNTVDLNTRGFQFYEG
LEQPQAVRVKFSGDYVSELSGSGGKKVAVVRLEPLLIGGLYPKNLEDRILIKLDQVPPYL
LDTLVTVEDRDFYHHFGVSPKSIARAVWVNTSSGAMRQGGSTLTQQLVKNFYLTNERSLT
RKLTEAMMAVLLELHYDKGEILEAYLNEVFVGQDGQRAVHGFGLASQFFFSQPLSELKLH
QVALLVGMVKGPSSYNPRRNPERAMERRNLVLDLLAQQGVATQEAVDAAKKMPLGVTKRG
SLADSSFPGFLDLVKRQLRDDYRDEDLTEEGLRIFTSFDPILQMKAESSVTDTFKRLAGR
KGSDEVEAAMVVTNPESGEVQALVGSRVPGFAGFNRALDAVRPIGSLIKPAVYLTALEQP
SKYTLTSWVQDVPFSVKGADGQIWKPQNYERNSNGTVFLYQGLAHSYNLSTARLGLDLGV
PNVLKTLGKLGVQVDWPAYPSMLLGAGGLAPMQVATMYQTLANGGFNTPMRGIRSVLTAE
GEPLKRYPFQIQQRFDPASIYLIQNAMQRVMREGTGRSVYSVLPSNLNLAGKTGTSNDSR
DSWFAGFSQDVLAVVWLGRDDNGKTPFTGATGALQVWTSFMKKADPLPLDTPVPENIVQA
WVDAKTGQGSDASCPNAVQMPYIRGSEPTPGTACGGANPATDDSVMDWVKGWLN
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgactcgaacccgatcttcccgtacccccaaaaaatcgccttcaggcggcctgcgcacc
tggcttggctggggcctcaagctgggcttggtaggcctggtgatcctggccggctttgcc
gtctacctggacgccgtggtccaggagaaattctccggcaagcgctggaccattcccgcc
aaggtgtacgcccgcccgctcgagctgttcgtcggccagaaactggccaagaatgatttc
ctgaccgaactcgacgcgcttggctaccgtcggcaaaccagtgtcgatggtccgggcacc
gactcggtcaacggcaatacggtcgacctcaatacccgcggcttccagttctacgagggc
cttgaacaaccccaggccgtgcgcgtgaagttttccggcgactatgtctcggaactcagc
ggcagtggtggcaagaaggttgccgtggtgcgtctcgagccgctgctgatcggcggtctt
tatccgaaaaacctcgaggaccgcatcctgatcaagctcgaccaggtgccgccgtacctg
ctcgacaccctggtgaccgtcgaggaccgcgacttctaccaccacttcggcgtctcgccc
aagtccatcgcccgcgccgtctgggtcaatacctcgtccggggccatgcgccagggtggc
agcaccttgacccagcagttggtcaagaacttctacctgaccaacgagcgcagcctgact
cgcaagttgactgaagcgatgatggcggtgctgctggaactgcactacgacaaaggtgaa
atcctcgaggcctacctcaacgaggtcttcgtcggccaggacggccagcgcgccgtgcac
ggcttcggtctggccagccagttcttcttcagccagccgctgtccgagctcaagctgcac
caggttgcgttgttggtgggcatggtgaaggggccgtcttcctataacccgcgccgcaat
ccggagcgggcgatggaacgccgcaacctcgttctcgacctgctggcccagcagggtgtg
gcaacccaggaggcggttgacgcggccaagaagatgccgctgggcgtgaccaagcggggc
agcctggcagacagctcgttccccggcttccttgatctggtcaagcgccagctgcgcgac
gactatcgcgatgaagacttgaccgaagaaggcctgcgcatcttcaccagcttcgaccct
atcctgcagatgaaagccgagtcgtcggttaccgacaccttcaagcgcctggccggacgc
aagggctcggacgaggtcgaggcggccatggtcgtcaccaaccccgaaagcggtgaagtg
caggccttggtcggcagtcgtgtaccgggcttcgccggtttcaaccgagcactcgatgcg
gtgcgcccgatcggctcgctgatcaagccagcggtgtacctgaccgcgctggagcaaccg
agcaaatacaccctgaccagttgggtgcaggacgtgccgttctcggtcaagggcgcagac
ggccagatctggaagccgcagaactacgaacgcaactccaacggcacggtgttcctctac
cagggccttgcccattcctacaacctgtcgacggcccgtttgggcctggacctgggcgtg
cccaacgtgctgaagaccctcggcaagctgggtgtacaggtcgattggccggcttaccca
tcgatgttgctgggggcgggcggcctggcacccatgcaggtggcaaccatgtatcagacc
ctggccaatggcggtttcaacacgccgatgcggggtatccgcagtgtgctgacagccgaa
ggtgaaccgctcaagcgctacccgttccagatccagcagcgcttcgatccggcctccatc
tacctgatccagaacgccatgcagcgggtgatgcgcgaaggtaccgggcgttcggtctac
agcgtgctgccgagcaacctgaacctggccggcaagaccggtaccagtaacgactcgcgc
gacagctggtttgccggcttcagtcaggacgtgctggccgtggtctggctgggccgtgac
gacaacggcaagacaccgttcaccggcgccaccggtgcgttgcaggtctggaccagcttc
atgaagaaagccgatccgctgccgttggatacaccggtgccggaaaacatcgtgcaagcc
tgggtcgacgccaagaccggacagggctctgacgcaagctgccccaacgccgtgcagatg
ccgtatattcgcggcagcgaaccgactccaggcaccgcatgcggcggcgccaatccggcc
accgacgattcggtgatggactgggtcaaaggctggttgaactaa

DBGET integrated database retrieval system