KEGG   Pseudomonas rhizosphaerae: LT40_14045Help
Entry
LT40_14045        CDS       T03339                                 

Gene name
hisZ
Definition
(GenBank) ATP phosphoribosyltransferase regulatory subunit
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
prh  Pseudomonas rhizosphaerae
Pathway
prh00340  Histidine metabolism
prh01100  Metabolic pathways
prh01110  Biosynthesis of secondary metabolites
prh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:prh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    LT40_14045 (hisZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His
Motif
Other DBs
NCBI-ProteinID: AIS18442
UniProt: A0A089YVP0
LinkDB All DBs
Position
complement(3113237..3114424)
Genome map
AA seq 395 aa AA seqDB search
MATVDRWLLPDGIEEVLPPEAARIEVARRQVLDLFQSWGYEFVVTPHIEYLESLLTGAGQ
DLDLRTFKVIDPQSGRQMGFRADITPQVARIDAHTLRREGPNRLCYAGSVLHAQPRALSS
SRSPIQLGAELYGDASPSSDVEVISLMLTMLEMADVPDVHMDLGHVGIYRGLARAAGLSG
DVEQQLFDALQRKAIDEVIALTQGLPADLAEMLRALVGLCGGREVLAQAKVRLANAPTAV
LTALDDLLAIAERLSLRFPELPLYFDLGELRGYHYHTGVVFAVFVPGMGQSIAQGGRYDD
IGADFGRARPATGFSTDLKSLVTLGQARIELPSGGVWMPDSTDAALWQAVCQLRREGQRV
VQALPGQTIEAAGEADCDRQLIQQNGQWQVLPLAS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggtagaccgctggctgctgccagatggcatcgaagaagtactgccgcctgag
gctgcgcgcatcgaagtcgcgcggcgccaggtgttggacctgttccagagctggggttac
gagttcgtcgtgaccccgcacatcgaatacctcgagtcgctgctgaccggcgccggccag
gaccttgatctgcgcaccttcaaggtgatcgacccgcaatcgggccggcagatgggtttc
cgtgccgacatcacgcctcaggtggcgcgtatcgatgcgcacaccctgcgccgcgaaggg
ccgaatcgtctgtgctatgccggcagcgtgctgcatgcgcagccgcgagcattgtccagc
tcgcgcagccccatccagctgggcgcggagctgtatggcgatgccagcccgagcagcgac
gtggaagtcatcagcctgatgctgaccatgctcgagatggccgacgtaccagacgtgcac
atggatctggggcatgtcggtatctaccgcggcctggcccgcgcggcgggcctgtcgggc
gacgtcgagcaacagttgttcgatgccttgcagcgcaaggccatcgacgaagtgattgcc
cttacccaagggctgccagccgacctggccgagatgctgcgcgccctggtcggactgtgt
ggcgggcgtgaagtgctggcccaggccaaggtacgtctggccaatgcaccgacggcagtg
ctgacggcgctggatgacctgctggcaatcgccgagcgcttgtcgttgcgttttccagaa
ttgccgctgtacttcgacctgggcgaactgcgcggttatcactaccacaccggcgtggtg
tttgccgtgttcgttccaggcatgggccagtccatcgcccagggcggccgctacgacgac
attggtgcggacttcggtcgcgcccgcccggccacggggttttccacggacctcaagtcc
ctggttaccttgggccaagcccggatcgaattgccgtccggcggcgtgtggatgcctgac
agcaccgatgcagcattgtggcaggcggtctgccagctgcgccgcgagggccagcgcgtg
gtccaggccctgccgggccagacgatcgaggctgctggcgaggcagattgcgaccgtcaa
ttgattcagcagaacggacaatggcaagtactgccactggcctcttga

DBGET integrated database retrieval system