KEGG   Paenibacillus riograndensis: PRIO_0737Help
Entry
PRIO_0737         CDS       T03849                                 

Gene name
ddl1
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pri  Paenibacillus riograndensis
Pathway
pri00473  D-Alanine metabolism
pri00550  Peptidoglycan biosynthesis
pri01100  Metabolic pathways
pri01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pri00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PRIO_0737 (ddl1)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PRIO_0737 (ddl1)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PRIO_0737 (ddl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pri01011]
    PRIO_0737 (ddl1)
Enzymes [BR:pri01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PRIO_0737 (ddl1)
Peptidoglycan biosynthesis and degradation proteins [BR:pri01011]
 Precursor biosynthesis
  Amino acid ligase
   PRIO_0737 (ddl1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: CQR52298
UniProt: A0A0E4CUK2
LinkDB All DBs
Position
I:821638..822729
Genome map
AA seq 363 aa AA seqDB search
MGDTKITVGLVYGGKSGEHEVSLQTAFAVMNAFDYAKYEIIPFYISKQGLWKVGAAMDAP
FGTIQELKLGGEAGDMSMALNAVFSGLTGGDQLIDVMFPLLHGTNGEDGTIQGLFEMANI
PYIGAGVLASSAGMDKVVMKKLFGEAGLDQCEYCYFNISAWKRKSHELIISLEDKLGYPV
FVKPANLGSSVGISKAVDKESLIKAVEVAFRYDTKVIIEEFVDAREVEVSVLGNEEPEAS
VPGEIVSSGEYYDYAAKYTDGKSQMLIPAPVDPEVADRLRESAIQAFRAIEGSGITRADF
FLRKSDGKILINEVNTMPGFTPYSMYPLLWRETGVSYQALLDRMIELALERYHFKQNLKY
DNE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggggatacaaaaataaccgtaggactggtgtacggcggcaaatccggagagcacgag
gtatcgctgcagacggcatttgcagttatgaacgcttttgactacgcgaaatatgagatt
atacctttttatatttccaagcaggggctttggaaggtcggagcggcgatggatgcccct
tttggaactatccaggaactgaagctgggcggcgaagccggagatatgagtatggcactg
aatgcggtgttcagcgggctgaccggcggtgatcagctgattgatgtgatgttcccgctg
ctgcacggcactaacggagaagacgggacgattcagggcctgttcgaaatggctaatatc
ccttatatcggggcgggtgtcctggcgtcgtctgcaggcatggataaagtggtcatgaag
aagctgttcggagaggccgggctggatcagtgtgaatactgctatttcaatatcagcgcc
tggaaacgcaaaagccatgagctgatcatcagcctggaggataagctgggttatccggta
ttcgtcaagccggccaatctgggctccagtgtaggcatttccaaagcggttgataaggag
agcctgattaaggcggtggaggtggccttccgctatgataccaaggtcattattgaagaa
tttgttgatgcgcgcgaggttgaagtcagtgtgctcggcaatgaggagccggaagcttcg
gttccgggtgaaatcgtctcttctggtgaatattatgattatgcggcaaaatacaccgac
ggcaaatcgcagatgctgattccggcccctgtggaccctgaggtggctgaccgtctgcgg
gagtcggcgattcaggcgttccgggcgattgagggcagcggcattacgcgcgccgacttc
ttcctgcgcaaatccgatggaaagattctcattaatgaagtgaatacaatgcccggtttc
acaccttacagcatgtatccgctgctgtggcgcgagaccggcgtatcgtatcaggccctg
ctggaccgcatgatcgagctggcgctggaacgttaccatttcaagcaaaatctgaagtac
gataacgaataa

DBGET integrated database retrieval system