KEGG   Paenibacillus riograndensis: PRIO_1237Help
Entry
PRIO_1237         CDS       T03849                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pri  Paenibacillus riograndensis
Pathway
pri03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pri00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    PRIO_1237
Enzymes [BR:pri01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PRIO_1237
DNA repair and recombination proteins [BR:pri03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PRIO_1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-ProteinID: CQR53211
UniProt: A0A0E4H858
LinkDB All DBs
Position
I:complement(1419439..1420401)
Genome map
AA seq 320 aa AA seqDB search
MKLQPVVPFEPVLASQLPEGGQWIAQIKWDGVRMLSYCDGSEAELINRRGNRRTLQYPEI
ADPRAYCRAGSVILDGEVIALSGGKPSFHEVMRRDSLKNAAAIKAVSPQVPVLYMVFDIL
YCNGTWLLDQPLSRRQQMLGEMLLPHPHVQAVPSYADPAELYAAAVRQGLEGIVCKDSGS
TYALGGKDKRWLKRKIIFDVTAVAGGVTFRDGTVNAVLLGLYDNEGKLHYIGHAGAGRMT
VQDWRDLTEQAHTLASETMPFAELPERSKGAFWIKPQLVFKVHYLEWNASGTLRHPSIQA
RVELAPQHCLLSQRDASVVN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcagcccgttgttcccttcgagcctgtgctggcatcgcagctgccggagggc
ggtcagtggattgcccagattaaatgggatggcgtgcgcatgctctcttactgtgacggg
agcgaagcggagctgattaaccgccgcggcaaccggcgcaccctgcagtatcccgaaatc
gccgaccccagagcctactgccgggccggctcggtcattttggacggagaagtgattgcg
ctcagcggcggcaaaccctccttccatgaggtgatgcgccgggacagcttgaagaatgct
gcggcgatcaaagccgtgagtccgcaggttcccgtgctgtatatggtatttgacattcta
tactgtaatggcacatggcttctggatcagccgctgtccagacggcagcagatgttaggc
gaaatgctgctcccgcatccgcatgtgcaggcggtgcccagctatgccgacccggcggag
ttgtatgccgctgcggtgcgccaggggcttgagggcattgtctgcaaggacagcggcagt
acctatgcgcttggaggcaaggacaagcgctggctaaagcggaagatcatcttcgacgta
acggctgtggcaggcggcgtcaccttccgggacggaacagtcaatgccgtgctgctcggc
ctctacgataacgagggcaagctgcattatatcggccatgccggggctggccggatgacc
gtgcaggactggcgtgacctgaccgagcaggcgcacactctggcttcggagactatgccg
tttgccgaactgccggagcggagcaagggcgcattctggatcaagccacagcttgtcttc
aaggttcattatctggaatggaatgcttcaggcacgctgcgccatccgagtatccaagcg
agagtcgaactggctccgcagcattgcctgctgagccagcgggatgcctccgtcgtcaac
taa

DBGET integrated database retrieval system