KEGG   Paenibacillus riograndensis: PRIO_1641
Entry
PRIO_1641         CDS       T03849                                 

Gene name
gtfA
Definition
(GenBank) Sucrose phosphorylase
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
pri  Paenibacillus riograndensis
Brite
KEGG Orthology (KO) [BR:pri00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PRIO_1641 (gtfA)
Enzymes [BR:pri01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     PRIO_1641 (gtfA)
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: CQR53952
UniProt: A0A0E4CVC1
LinkDB
Position
I:1865921..1867387
AA seq 488 aa
MVKNQVQLITYPDSLGGDLKSLHHALDVYFPDVFKGGVHILPPFPSSGDRGFAPLTYLEI
EPAFGDWADIRAIGERHDVLVDLMVNHISRQSPYFQDVLQHGRQSRYADLFLTLDKIWAD
GQPVQADIDKMFLRRSKPYSTFTIQDTGEELQVWTTFGKNDPSEQIDLDIRSEKVKQLFI
QFFTCFKENNIKIVRLDAVGYVIKKLGTSCFFVEPEIYGFLDWIKELADSLDIELLPEVH
SHYSIQYKLAEHGCWIYDFILPYRILDTLLNKDSRGLREYLRTRPAKQFTMLDCHDGVPV
KPDLDDLIDTKDAQKIVDICVERGANLSLILSDEHKAPDGFDVHQIRCSYYSVLNCDDDA
YLAARAIQFFAPGIPQVYYVGLLAGENDLERVRETGEGREINRRNYTLPEIGQSLEKEVV
QRLLKLIRFRNEYEAFNGDFTVEEAAADEIRLSWKKGEFRCTLYINLDTMRSEIEYTDGE
GVLAQLEV
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggttaaaaatcaagtgcaactgattacgtacccggactcgcttggcggggatttgaag
tcgcttcatcatgcgctggatgtgtattttccggatgtgttcaagggcggggtgcatatt
ctgcctccattcccttcgtcgggggaccgcggttttgcaccgctgacctatctggagatt
gagcctgcctttggggattgggccgacatccgggcaatcggggagcggcatgatgtgctg
gtggacctgatggtcaatcatatctcccgccagtccccttactttcaggacgtcctgcag
cacgggcggcagtcccgctacgcagatctgttccttacgctggataaaatctgggcggac
ggacaaccggtacaggcggatatcgacaaaatgttcctgcgccgcagtaagccctactcc
actttcaccattcaggacacaggggaagagcttcaggtgtggacgaccttcggcaaaaac
gatccgtccgagcagattgatctggatatccgctcggagaaggtcaagcagctgttcatc
caattcttcacctgctttaaggagaacaatatcaagatcgtccggctggatgcggtaggc
tatgtgatcaaaaagctgggcaccagctgctttttcgttgagccggagatttatggcttt
ctggactggatcaaggagctggccgattcccttgatatcgaactgctgcccgaggtgcat
tcgcactattcgattcaatacaagctggcggagcacggctgctggatttacgattttatc
ctgccttaccggattcttgatacgctgctgaacaaggacagccgtgggcttagagagtac
ttgcgcacccgtccagccaaacagttcacaatgcttgactgtcatgacggcgtgccggtc
aagcctgacctggacgatctgatcgacacgaaggatgcccagaagatcgttgacatctgt
gtcgaaagaggggccaacctgagccttatcttatccgatgagcacaaggcgcctgatggg
ttcgacgtccatcaaatccgctgctcctattactcggtgctgaactgcgatgacgatgca
tatttggcggcgcgggcgattcagttttttgctccgggcattccgcaggtgtattatgtc
gggctgctggctggtgaaaatgatctggagcgggtgcgggaaaccggcgagggacgcgaa
atcaaccgccgcaactatacgctcccggaaatcgggcaatcgctggaaaaggaagttgta
cagcgtctgcttaagctgatccggttcagaaatgaatacgaggcgtttaacggcgacttt
acagtggaggaagctgcagcggatgaaatcagattgtcctggaagaagggcgaattccgc
tgcacgctgtacattaaccttgatacgatgcgctctgagattgaatatacggacggggag
ggcgtgctggcgcagcttgaggtgtag

DBGET integrated database retrieval system