KEGG   Paenibacillus riograndensis: PRIO_2256
Entry
PRIO_2256         CDS       T03849                                 

Definition
(GenBank) sucrose phosphorylase
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
pri  Paenibacillus riograndensis
Brite
KEGG Orthology (KO) [BR:pri00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PRIO_2256
Enzymes [BR:pri01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     PRIO_2256
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: CQR54665
UniProt: A0A0E4H9J0
LinkDB
Position
I:2753658..2755127
AA seq 489 aa
MAIHNQVQLITYPDSLGGSLQTLNHVLDEHFSDIFKGGIHILPPFPSSGDRGFAPLTYFE
IEPAFGAWEDIRAIGAKHDVLLDVMVNHISRQSEYFQDFLRQGRRSPYADLFLTLDKIWA
GGQPVQADIDKMFLRRPLPYSTFTIEETGEEEKVWTTFGKTDPSEQIDLDIHSDKVKRLL
ADIFENFRNNNVKIVRLDAVGYIIKKLGTSCFFVEPEIYGFLDWIKEVTDSLDIELLPEV
HSHYSIQYKLAEHGFWIYDFILPYRILDTLVNKNAEALKEYLTTRPAKQFTMLDCHDGIP
VKPDLDGLIDTKEARRLVDTCLERGSNLSLIVSDEHKAEDGFDVHQVRCSYYSVLNSDDD
AYLAARAIQFFAPGIPQVYYVGLLAGENDEEGVRRTGEGREINRHNFSIDEIEQALGKSA
VQRLLALIRFRNEYGAFNGDFRVLEAASNEVRLEWTKGDLRCTLYIDLSTNRTVIDYVET
EGMSVQFEV
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcaattcataatcaagtacaactaattacgtatcccgactcgctgggcgggagcctg
cagaccttaaaccacgtgctggatgagcatttttcagatattttcaagggcggcattcat
atccttcctccatttccctcctcgggagaccgcggattcgctccgcttacttattttgag
attgagcctgcattcggtgcttgggaggacattagggcgatcggggcgaaacatgatgtg
ctgctggatgtgatggtcaatcatatttcccggcagtcggagtattttcaggatttcctg
aggcagggaagacgctcgccctacgcggatttattcctgacactcgacaaaatctgggca
ggcggacagcctgttcaagccgatatcgacaaaatgtttctccgccgtcccttgccgtat
tccacgttcactattgaagagacgggtgaagaggagaaggtgtggacgactttcggcaaa
accgatccttcggaacagattgacctcgacattcattcggacaaggtaaaacgtctgctg
gccgatatctttgaaaatttccgtaacaacaacgtcaagattgtgcggctggatgccgta
ggctacatcatcaagaagctgggcacgagctgcttcttcgtggagcctgaaatttacggc
tttctggactggatcaaggaggtgaccgattcgctggatatcgagctgctgccggaggtt
cattcccactacagcattcaatataaactggcggagcacggtttttggatttatgatttc
atcctgccttaccgcattctcgatactctcgtcaataaaaatgcagaagcgctgaaggaa
tacctgaccacgcgtcctgcaaagcagttcacgatgctggactgccatgacggcatcccc
gtcaagcccgatctcgacggattgatcgacacgaaggaagcgcgcaggctggtcgatact
tgtcttgaacgcggctccaacctgagccttatcgtctccgatgagcataaggctgaggac
gggttcgatgtgcaccaggtccgctgctcctactattccgtgctgaacagcgatgatgac
gcttatctggcggcccgtgccatccagttcttcgctccgggcatcccgcaggtgtattac
gtcggacttttggccggagagaacgatgaagaaggagttcgccgcacaggagaagggcgg
gaaatcaaccgtcataacttcagtatagacgagattgagcaggcgcttggcaaaagcgca
gtccagcgtcttcttgcgctgatccggttccgcaacgaatacggcgcctttaacggcgat
ttccgcgtactggaagcggcaagtaatgaggtccggctggagtggaccaagggtgatctg
cgctgcacactgtatattgacctgagcactaaccggacggtcattgattacgtggagacg
gaagggatgagtgttcagtttgaggtgtaa

DBGET integrated database retrieval system