KEGG   Paenibacillus riograndensis: PRIO_2357Help
Entry
PRIO_2357         CDS       T03849                                 

Definition
(GenBank) alpha amylase catalytic region
Organism
pri  Paenibacillus riograndensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase CBM_25 CBM53 RGI_lyase CBM_20 fn3 AMPK1_CBM DUF1966
Motif
Other DBs
NCBI-ProteinID: CQR54766
UniProt: A0A0E4H8R7
LinkDB All DBs
Position
I:2876153..2879194
Genome map
AA seq 1013 aa AA seqDB search
MKRKLWLIPALITSIVLSITANLFVLPPTQVEAASIGTVTENDTIYQIMVDRFNDGDTSN
NATGAAIRYGENSEEDFRYMKGGDWQGVIDKLPYIHNMGYTAIWISPVAEPQVTSRDNNG
TGKNTAYHGYNVKNPNAANPYFGTKEKLKELVDSAHALGIKVIIDVVPNHIGDYMLGSQA
YYDIPGLQPAAPFNNPAWYHHNGDINWSLADGRYDQWAQDYMENHDLGGLDDLDLDVPAA
KQAIFNSIKGWFDYTGADGARVDAAKLIKPTDIGELQNLLGVNTFGENFDGNAEFVSRWV
GPNKEWGMLDFPLFFSVLNSFAYGQSFDSNIKSTLAQDSYYNGNANHMVTFIDNHDRNRF
LTEAGGNVDKMQNALSFIFTVRGTPVVFQGTEQNKGNGNGQIMTGGIADTWNRWSMVKRD
AGGNVLENYFNENTSTYKHIAKLNDIRKNNPALRTGTQREMWSAQNLYAFSRRIDSGTNV
GQEVISVFSNASGGSQTVTIPLRAESSLTAGTVLINQLNTSDKVTVQAGGTTGKQITVTV
GANSAKIYSKTQPVVDTEAPSVPSNVTATVQNASSVLVNWTASTDNVGVTGYEIYRNGVK
VGTSATTSYTDNTVASQTNYSYTVKAFDAAGNLSAFSAAALVTTPAGNNVTIYYKQGYTT
PYIHYRPVGGTWTAAPGVAMPAAEVSGYNKITINIGSATQLEAAFNNGSGTWDSNGGSNY
LFGTGTWTYTPTGNIKSGGPVTPTTTPTPTPTATPTPTPTATPTATPTPTPTATPTPTPT
ATPTATPTPTATPTATPTATPTVTPTVTPTATPVGNSVTIYYKNTAFTNSYIHYKLDGST
VWTTSPGEQMQASSYSGYKAATIQLGSAAGLTAAFNNGSGAWDNNGSSNYHFGAGTWSLV
NGSIAAGEPQADSVTFRVSVPGTTPANGPLYLTGSFNSWNAADPAYQLTKGSDGVYSVTV
SLPAGTAVQYKITRGGWDTVETSSSGADIANRTLTPAGGAQTVNLTVQRWKDQ
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaaactatggcttattccggctctaattacgtccattgttctgtctattacg
gctaacttgtttgtgcttccgcctacacaggttgaggcagccagcattggtactgttact
gaaaatgacacgatttatcaaattatggtagatcgcttcaatgacggggatacctccaat
aatgctaccggtgcggctatccgctacggcgaaaactcggaggaggatttccgctatatg
aagggtggcgattggcaaggggttatagacaagctgccctatattcataacatggggtat
accgcgatttggatctctccggtggcagaaccgcaggtgacaagtcgtgacaacaacggt
acaggaaaaaacacagcgtaccacggttacaatgttaaaaaccccaatgctgccaatcct
tactttggaaccaaagaaaagcttaaggaactggtggattccgcgcatgcgctcggcata
aaagttattatcgacgttgtgccgaatcacatcggagactatatgctgggcagtcaggct
tattatgatattccaggactgcagcccgcagctccgttcaataatccggcctggtatcac
cataatggcgatattaactggtcattggctgacggaagatatgatcagtgggctcaggat
tatatggagaatcacgatcttggcgggctggatgatctcgaccttgacgtccctgcggcc
aaacaggctatattcaattccattaaagggtggtttgactacacgggagcagacggtgcg
cgtgtggatgccgccaagctgatcaagccgacggatatcggtgaactgcagaatcttctg
ggagttaatacttttggtgagaattttgacggcaatgccgaatttgtctcccgctgggtt
ggtcccaacaaggagtggggcatgcttgacttcccgctgttcttctcggtgctgaacagt
ttcgcttacggacagtcctttgattccaacattaagagcacacttgctcaggattcttat
tacaacgggaatgcgaaccatatggttacctttatcgacaatcatgaccgcaaccgtttc
ctaacggaagccggaggcaatgtagacaaaatgcagaacgcattgtcttttatctttacg
gtccgtggaacaccggtggtttttcaggggactgaacagaataaaggcaacgggaacggc
cagattatgacaggcggaatcgctgatacttggaaccgctggtccatggtaaagcgggat
gcgggcggcaacgttttggagaattactttaatgagaatactagcacttataagcatatt
gccaaactgaatgatatccgcaaaaataatccggcgctgcgcacaggcacccagcgtgaa
atgtggtcagcccagaatctgtacgccttctcgcgccgtatagacagcggaaccaatgtg
ggacaggaagtcatttctgttttcagcaatgcatcgggcggttcacagacagttacaatt
ccgctgcgcgcggaaagctctctgactgcaggaacagttctgattaatcaacttaatact
tccgacaaggtaacggtgcaggcaggtggaacaaccggcaagcaaattaccgtaacagtg
ggagcgaattcggccaaaatctattccaaaacacagccggtagtagataccgaggcaccg
tctgttccaagcaatgtaacagccaccgtgcagaatgcatccagtgtgctcgtaaattgg
acagcttctacggataatgtcggggttaccggttatgaaatttaccgcaacggagtcaaa
gtaggcacatcagcaaccacatcgtatacggataatactgtagcatcgcagaccaattac
agctatacggtaaaagcttttgatgccgcagggaacctgtcggcattcagcgcagcggct
ctggtgaccactccagccggaaataatgtaacgatctactataagcaaggctacactaca
ccttacatccactaccgtcctgttggcggcacctggacggcagcaccgggagtagccatg
ccggcagccgaagtgtccggctataacaagatcacgatcaatatcggctccgccacccag
ttggaggccgcttttaataatggcagcggcacctgggacagcaacggcggcagcaattat
ctgttcggcaccggcacctggacctacacacctacaggaaacatcaaatcggggggaccg
gtgacaccgacaaccacaccaacaccgacgccaacggctacaccaacaccgacgccaacg
gccacaccaacagcaacaccaacaccgacgccaacagccacgccaacaccgacgccaacg
gccacaccaacagcaacaccgacgccaacagccacgccaacggctacaccaacagccaca
ccaacggtaacaccgactgttacacctacggcaacaccagttggcaattcagtgaccatt
tattacaaaaacacagcatttacgaactcttatattcattataagctggacggatcgaca
gtgtggaccacttctccgggagagcagatgcaggcatcatcttactctggctataaggcg
gctacgatccaattgggcagtgccgcagggctgaccgccgcctttaacaatggcagcggg
gcgtgggacaacaacggcagcagcaattaccactttggagcaggcacgtggagcctggtg
aacggcagcattgctgcaggagaaccgcaggcggacagcgtgactttccgggtgagcgtg
ccgggtacaactcctgcaaacggaccgctgtacttaaccggaagcttcaacagctggaac
gcagcggacccggcgtaccaattgaccaaaggcagcgatggagtctattccgtcacagtg
agcctgcccgcaggtacggcggtgcaatacaagatcacacgcggaggctgggacactgtg
gagaccagctcaagcggtgcggatattgcgaaccggacgctgacaccagccggtggagcg
caaaccgttaacctgactgtacagcgctggaaggatcaataa

DBGET integrated database retrieval system