KEGG   Paenibacillus riograndensis: PRIO_2544Help
Entry
PRIO_2544         CDS       T03849                                 

Definition
(GenBank) hypothetical protein
  KO
K03704  cold shock protein
Organism
pri  Paenibacillus riograndensis
Brite
KEGG Orthology (KO) [BR:pri00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    PRIO_2544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-ProteinID: CQR54949
UniProt: A0A0E4CW60
LinkDB All DBs
Position
I:3092752..3092949
Genome map
AA seq 65 aa AA seqDB search
MKGTVKWFNAEKGYGFLQVEGGEDVFVHFSAIQGDGFKTLDEGQAVEFDITDGNRGPQAA
NVVKL
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggtacagtaaaatggtttaacgcagaaaaaggctatggttttcttcaagtagaa
ggcggcgaagatgtattcgttcacttctcagcaatccaaggtgacggattcaagactttg
gatgaaggccaagcggtagaattcgatattactgatggtaaccgcggtccccaagcagct
aacgtagttaaattataa

DBGET integrated database retrieval system